Search by BoMiProt ID - Bomi3556


Primary Information

BoMiProt ID Bomi3556
Protein Name 60S ribosomal protein L30
Organism Bos taurus
Uniprot IdQ3T0D5
Milk FractionWhey
Ref Sequence Id NP_001029606.1
Aminoacid Length 115
Molecular Weight 12784
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0D5.fasta
Gene Name RPL30
Gene Id 513031
Protein Existence Status reviewed

Secondary Information

Protein Function  Formation of a pool of free 40S subunits.SRP-dependent cotranslational protein targeting to membrane.
Significance in milk regulation of milk protein synthesis
PTMs N6-acetyllysine , Phosphorylation on Ser,Glycyl lysine isopeptide (Lys-Gly)
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0D5|RL30_BOVIN 60S ribosomal protein L30 OS=Bos taurus OX=9913 GN=RPL30 PE=3 SV=3 MVAAKKTKKS*10LESINS*16RLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEI EYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
Predicted Disorder Regions 3 disordered segments; (1-19), (25-38), (105-115)
DisProt Annotation
TM Helix Prediction No TM helices