Search by BoMiProt ID - Bomi3555


Primary Information

BoMiProt ID Bomi3555
Protein Name 60S ribosomal protein L28
Organism Bos taurus
Uniprot IdQ3T0L7
Milk FractionWhey
Ref Sequence Id NP_001030580.1
Aminoacid Length 137
Molecular Weight 15692
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0L7.fasta
Gene Name RPL28
Gene Id 618702
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the large ribosomal subunit
Significance in milk milk fat synthesis
PTMs Acetylation,Phosphorylation,
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0L7|RL28_BOVIN 60S ribosomal protein L28 OS=Bos taurus OX=9913 GN=RPL28 PE=2 SV=3 MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGV VVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRAS*115AILRS QKPVMVKRKPSRPTKSS
Predicted Disorder Regions 4 disordered segment; (22-35), (53-76), (85-93), (98-137)
DisProt Annotation
TM Helix Prediction No TM helices