Search by BoMiProt ID - Bomi3551


Primary Information

BoMiProt ID Bomi3551
Protein Name 60S ribosomal protein L23
Organism Bos taurus
Uniprot IdQ3T057
Milk FractionWhey
Ref Sequence Id NP_001030186.1
Aminoacid Length 140
Molecular Weight 14865
Fasta Sequence https://www.uniprot.org/uniprot/Q3T057.fasta
Gene Name RPL23
Gene Id 504876
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T057|RL23_BOVIN 60S ribosomal protein L23 OS=Bos taurus OX=9913 GN=RPL23 PE=2 SV=2 MSKRGRGGSSGAKFRIS*17LGLPVGAVINCADNTGAKNLY*38IISVKGIKGRLNRLPAAGVGDM VMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGP VAKECADLWPRIASNAGSIA
Predicted Disorder Regions 1-12, 67-87
DisProt Annotation
TM Helix Prediction No TM helices