Search by BoMiProt ID - Bomi3545


Primary Information

BoMiProt ID Bomi3545
Protein Name 60S ribosomal protein L13
Organism Bos taurus
Uniprot IdQ56JZ1
Milk FractionWhey
Ref Sequence Id NP_001015543.1
Aminoacid Length 211
Molecular Weight 24292
Fasta Sequence https://www.uniprot.org/uniprot/Q56JZ1.fasta
Gene Name RPL13
Gene Id 508221
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q56JZ1|RL13_BOVIN 60S ribosomal protein L13 OS=Bos taurus OX=9913 GN=RPL13 PE=2 SV=3 MAPSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPAS*52GPLRPVVR CPTVRYHTKVRAGRGFS*77LEELRVAGIHKKVARTIGISVDPRRRNKCTESLQANVQRLKEY RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARVITEEEKNFKAFA SLRMARANARLFGIRAKRAKEAAEQDVEKKK
Predicted Disorder Regions 1-84, 89-94, 104-108, 129-142, 196-211
DisProt Annotation
TM Helix Prediction No TM helices