Search by BoMiProt ID - Bomi3543


Primary Information

BoMiProt ID Bomi3543
Protein Name 60S acidic ribosomal protein P1
Organism Bos taurus
Uniprot IdQ56K14
Milk FractionWhey
Ref Sequence Id NP_001020511.1
Aminoacid Length 114
Molecular Weight 11514
Fasta Sequence https://www.uniprot.org/uniprot/Q56K14.fasta
Gene Name RPLP1
Gene Id 533285
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  isthmus of fallopian tube 
Protein Function RPLP1 (ribosomal protein large P1) is part of the 60S ribosomal subunit and functions in regulating elongation translation factors. It is associated with cell proliferation and invasion.
PTMs N-acetylation at Ala,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q56K14|RLA1_BOVIN 60S acidic ribosomal protein P1 OS=Bos taurus OX=9913 GN=RPLP1 PE=3 SV=1 MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLI CNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEES*101EESDDDMGFGLFD
Predicted Disorder Regions 1-12, 63-114
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Alali Z, Graham A, Swan K, Flyckt R, Falcone T, Cui W, Yang X, Christianson J, Nothnick WB. 60S acidic ribosomal protein P1 (RPLP1) is elevated in human endometriotic tissue and in a murine model of endometriosis and is essential for endometriotic epithelial cell survival in vitro. Mol Hum Reprod. 2020 Jan 1;26(1):53-64. doi: 10.1093/molehr/gaz065. PMID: 31899515; PMCID: PMC8204708. 2.Guo QM, Malek RL, Kim S, Chiao C, He M, Ruffy M, Sanka K, Lee NH, Dang CV, Liu ET. Identification of c-myc responsive genes using rat cDNA microarray. Cancer Res 2000;60:5922–5928.