Search by BoMiProt ID - Bomi3542


Primary Information

BoMiProt ID Bomi3542
Protein Name 60S acidic ribosomal protein P0
Organism Bos taurus
Uniprot IdQ95140
Milk FractionWhey,exosome
Ref Sequence Id NP_001012700.1
Aminoacid Length 318
Molecular Weight 34371
Fasta Sequence https://www.uniprot.org/uniprot/Q95140.fasta
Gene Name RPLP0
Gene Id 86868
Protein Existence Status reviewed

Secondary Information

Protein Function a ribosomal protein, can interact with PLAAT4 and involved in PLAAT4-mediated growth inhibition and cellular apoptosis.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95140|RLA0_BOVIN 60S acidic ribosomal protein P0 OS=Bos taurus OX=9913 GN=RPLP0 PE=2 SV=3 MPREDRATWKSNYFLKIIQLLDDY*24PKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNT*59M MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAAPAAAPAATTAAPAKVE AKEES*305EES*308DEDMGFGLFD
Predicted Disorder Regions 2 disordered segments; (1-5), (284-318)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs In Arabidopsis phosphorylation of Ser-103 in the 60S acidic ribosomal protein P1 (isoforms P1-1, P1-2, P1-3) and of Ser-305 in the 60S acidic ribosomal protein P0-2 had been detected
Bibliography 1.Turkina, M. V., Klang Årstrand, H., & Vener, A. V. (2011). Differential phosphorylation of ribosomal proteins in Arabidopsis thaliana plants during day and night. PloS one, 6(12), e29307. https://doi.org/10.1371/journal.pone.0029307 2.Wang CH, Wang LK, Wu CC, Chen ML, Lee MC, Lin YY, Tsai FM. The Ribosomal Protein RPLP0 Mediates PLAAT4-induced Cell Cycle Arrest and Cell Apoptosis. Cell Biochem Biophys. 2019 Sep;77(3):253-260. doi: 10.1007/s12013-019-00876-3. Epub 2019 May 26. PMID: 31131438.