Search by BoMiProt ID - Bomi3541


Primary Information

BoMiProt ID Bomi3541
Protein Name 60 kDa heat shock protein, mitochondrial/60 kDa chaperonin/Chaperonin 60/Heat shock protein 60/Mitochondrial matrix protein P1
Organism Bos taurus
Uniprot IdP31081
Milk FractionWhey
Aminoacid Length 573
Molecular Weight 61108
Fasta Sequence https://www.uniprot.org/uniprot/P31081.fasta
Gene Name HSPD1/HSP60
Protein Existence Status reviewed

Secondary Information

Protein Function mitochondrial protein import and macromolecular assembly
PTMs Acetylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P31081|CH60_BOVIN 60 kDa heat shock protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPD1 PE=1 SV=2 MLRLPAVLRQMRPVSRALALHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR TVIIEQS*67WGS*70PRVTKDGVTVAKSIDLKDKY*90KNIGAKLVQDVANNTNEEAGDGTTTATVLA RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIVELKKQSKPVTTPEEIAQVATISANGDK EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ DAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV KAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQPHDLGKVGEVIVTKDDAMLLKG KGDKAQIEKRIQEIIEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTS*410DVEVNEKKDR VTDALNATRAAVEEGIVLGGDCALLRCIPALESITPANEDQKTGIEIIKKTLKIPAMTIA KNAGVEGS*488LIVEKIMQSSSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT TAEVVVTEIPKEEKDPGMGGMGGMGGGMGGGMF
Predicted Disorder Regions 2 disordered segments; (1-22), (553-564)
DisProt Annotation
TM Helix Prediction No TM helices