Search by BoMiProt ID - Bomi3539


Primary Information

BoMiProt ID Bomi3539
Protein Name 5-oxoprolinase/5-oxo-L-prolinase/5-Opase/Pyroglutamase
Organism Bos taurus
Uniprot IdQ75WB5
Milk FractionWhey
Ref Sequence Id NP_001001173.1
Aminoacid Length 1288
Molecular Weight 137450
Fasta Sequence https://www.uniprot.org/uniprot/Q75WB5.fasta
Gene Name OPLAH
Gene Id 408006
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Expressed in coronary artery and kidney.
Protein Function  is required for glutathione metabolic process
Biochemical Properties Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate. 5-oxo-L-proline + ATP + 2 H2O = ADP + H+ + L-glutamate + phosphate
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q75WB5|OPLA_BOVIN 5-oxoprolinase OS=Bos taurus OX=9913 GN=OPLAH PE=1 SV=1 MGGPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYVDAPTEGIRRILEQEGG VLLPRDRPLDTSRIASIRMGTTVATNALLEQQGERVALLVTRGFRDLLHVCTQARAXLFD LAVPMPETLYEEVLEVDERVVLYRGXPGAGT*151PVKGCTGDLLEVQQPVDLGGLRWKLEGLL SRGIRSLAVVLMHSYTWAQHEQQVGALARELGFTHVSLSSEAMPMVRIVPRGHTACADAY LTPTIQRYVQGFRRGFQGQLKDVQVLFMRSDGGLAPMDSFSGSRAVLSGPAGGVVGYSAT TYRVEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSP EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLPYA PETFAQLDQRLGRLEEQCVEALRAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPASA RSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGSSSLRLEDVPKAHSGPPRVD KMTQCYFEGGYQETPVYLLGELGCGHKLQGPCLIIDSNSTILVEPGCQAEVTETGDIRIS VGAETASVVGTQLDPIHLTIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG GLVSNVPHIPVHLGAMQETVQFQIQQLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW PGQTRPVFYVASRGHHADIGGITPGSMPPHSTSLQQEGAVFLSFKLVHGGVFQEEAVTEA LRAPGKIPGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA ELAVRDMLRAFGTARQARGLPLEVSAEDHMDDGSPIRLRVQINMSQGSAVFDFSGSGPEV FGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPKGSILDPSPDAAVVGGNV LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPGWHGRSGVHSHM TNTRITDPEILESRYPVILRRFELRLGSGGRGRFRGGDGIIRELLFREEALLSVLTERRA FQPYGLMGGEPGARGLNLLIRKDGRTVNLGGKTSVPVYPGDVFCLHTPGGGGYGDPGDPA PLPGS*1265PLQPLAFPERGSVYEYRRAQEAV
Predicted Disorder Regions 1249-1265
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Yang P, Chen Y, Wu H, Fang W, Liang Q, Zheng Y, Olsson S, Zhang D, Zhou J, Wang Z, Zheng W. The 5-oxoprolinase is required for conidiation, sexual reproduction, virulence and deoxynivalenol production of Fusarium graminearum. Curr Genet. 2018 Feb;64(1):285-301. doi: 10.1007/s00294-017-0747-y. Epub 2017 Sep 16. PMID: 28918485.