Search by BoMiProt ID - Bomi3526


Primary Information

BoMiProt ID Bomi3526
Protein Name 40S ribosomal protein S8
Organism Bos taurus
Uniprot IdQ5E958
Milk FractionExosomes
Ref Sequence Id NP_001020488.1
Aminoacid Length 208
Molecular Weight 24205
Fasta Sequence https://www.uniprot.org/uniprot/Q5E958.fasta
Gene Name RPS8
Gene Id 404140
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E958|RS8_BOVIN 40S ribosomal protein S8 OS=Bos taurus OX=9913 GN=RPS8 PE=2 SV=3 MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRL DVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALP LGRKKGAKLT*130PEEEEILNKKRSKKIQKKYDERKKNAKISLLEEQFQQGKLLACIASRPG QCGRADGYVLEGKELEFYLRKIKARKGK
Predicted Disorder Regions 1-38, 131-154, 200-208
DisProt Annotation
TM Helix Prediction No TM helices