Search by BoMiProt ID - Bomi3524


Primary Information

BoMiProt ID Bomi3524
Protein Name 40S ribosomal protein S6
Organism Bos taurus
Uniprot IdQ5E995
Milk FractionWhey
Ref Sequence Id NP_001015548.1
Aminoacid Length 249
Molecular Weight 28667
Fasta Sequence https://www.uniprot.org/uniprot/Q5E995.fasta
Gene Name RPS6
Gene Id 787914
Protein Existence Status Reviewed

Secondary Information

Protein Function Ribosomal protein S6 (RPS6) is a component of the 40S small ribosomal subunit and participates in the control of mRNA translation. 
Biochemical Properties RPS6 has five evolutionarily conserved C-terminal serine residues (S235, S236, S240, S244, and S247) that are phosphorylated by various protein kinases.
PTMs N6-Acetylation at Lys, Hydroxylation, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E995|RS6_BOVIN 40S ribosomal protein S6 OS=Bos taurus OX=9913 GN=RPS6 PE=2 SV=1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD IPGLTDTTVPRRLGPKRASRIRKLFNLS*148KEDDVRQYVVRKPLNKDGKKPRTKAPKIQRLV TPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLS*235S*236LRAS*240 TS*242KS*244ESS*247QK
Predicted Disorder Regions 80-90, 138-145, 152-209, 218-249
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs RPS6 is also phosphorylated at S235/236 by PAS domain-containing serine/threonine-protein kinase (PASK), which regulates translation and glycogen synthesis in mammalian cells.
Bibliography 1.Yi YW, You KS, Park JS, Lee SG, Seong YS. Ribosomal Protein S6: A Potential Therapeutic Target against Cancer? Int J Mol Sci. 2021 Dec 21;23(1):48. doi: 10.3390/ijms23010048. PMID: 35008473; PMCID: PMC8744729. 2.Schläfli P., Tröger J., Eckhardt K., Borter E., Spielmann P., Wenger R.H. Substrate preference and phosphatidylinositol monophosphate inhibition of the catalytic domain of the Per-Arnt-Sim domain kinase PASKIN. FEBS J. 2011;278:1757–1768. doi: 10.1111/j.1742-4658.2011.08100.x.