Search by BoMiProt ID - Bomi3519


Primary Information

BoMiProt ID Bomi3519
Protein Name 40S ribosomal protein S28
Organism Bos taurus
Uniprot IdQ56JX6
Milk FractionWhey,exosome
Ref Sequence Id NP_001020487.1
Aminoacid Length 69
Molecular Weight 7841
Fasta Sequence https://www.uniprot.org/uniprot/Q56JX6.fasta
Gene Name RPS28
Gene Id 282877
Protein Existence Status reviewed

Secondary Information

Protein Function structural constituent of ribosome
Biochemical Properties Ribosomal protein S28 has 69 amino acids and has a molecular weight of 7,836.
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q56JX6|RS28_BOVIN 40S ribosomal protein S28 OS=Bos taurus OX=9913 GN=RPS28 PE=3 SV=1 MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRS*41IIRNVKGPVREGDVLTLLE SEREARRLR
Predicted Disorder Regions 1 disordered segment; (1-69)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Chan YL, Olvera J, Wool IG. The primary structure of rat ribosomal protein S28. Biochem Biophys Res Commun. 1991 Aug 30;179(1):314-8. doi: 10.1016/0006-291x(91)91371-i. PMID: 1679328.