Primary Information |
---|
BoMiProt ID | Bomi3519 |
---|
Protein Name | 40S ribosomal protein S28 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q56JX6 |
---|
Milk Fraction | Whey,exosome |
---|
Ref Sequence Id | NP_001020487.1 |
---|
Aminoacid Length | 69 |
---|
Molecular Weight | 7841 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q56JX6.fasta |
---|
Gene Name | RPS28 |
---|
Gene Id | 282877 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | structural constituent of ribosome |
---|
Biochemical Properties | Ribosomal protein S28 has 69 amino acids and has a molecular weight of 7,836. |
---|
PTMs | Acetylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q56JX6|RS28_BOVIN 40S ribosomal protein S28 OS=Bos taurus OX=9913 GN=RPS28 PE=3 SV=1
MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRS*41IIRNVKGPVREGDVLTLLE
SEREARRLR
|
---|
Predicted Disorder Regions | 1 disordered segment; (1-69) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Chan YL, Olvera J, Wool IG. The primary structure of rat ribosomal protein S28. Biochem Biophys Res Commun. 1991 Aug 30;179(1):314-8. doi: 10.1016/0006-291x(91)91371-i. PMID: 1679328. |