Search by BoMiProt ID - Bomi3513


Primary Information

BoMiProt ID Bomi3513
Protein Name 40S ribosomal protein S2
Organism Bos taurus
Uniprot IdO18789
Milk Fractionwhey
Aminoacid Length 293
Molecular Weight 31235
Fasta Sequence https://www.uniprot.org/uniprot/O18789.fasta
Gene Name RPS2
Gene Id 286867
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a structural constituent of ribosome which is involved in RNA binding
PTMs Acetylation, Citrullination, Isopeptide bond, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O18789|RS2_BOVIN 40S ribosomal protein S2 OS=Bos taurus OX=9913 GN=RPS2 PE=2 SV=2 MADDAGAAGGPGGPGGPGMGGRGGFRGGFGSGVRGRGRGRGRGRGRGRGARGGKAEDKEW LPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQ RTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTV PCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKAT FDAISKTYSYLT*252PDLWKETVFTKS*264PYQEFTDHLVKTHTRVS*281VQRTQAPAVATT
Predicted Disorder Regions 1-54, 285-293
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Citrullinated by PADI4 in the Arg/Gly-rich region.Asymmetric arginine dimethylation by PRMT3 occurs at multiple sites in the Arg/Gly-rich region.
Bibliography Choi, S., Jung, C. R., Kim, J. Y., & Im, D. S. (2008). PRMT3 inhibits ubiquitination of ribosomal protein S2 and together forms an active enzyme complex. Biochimica et biophysica acta, 1780(9), 1062–1069. https://doi.org/10.1016/j.bbagen.2008.05.010