Search by BoMiProt ID - Bomi3507


Primary Information

BoMiProt ID Bomi3507
Protein Name 40S ribosomal protein S10
Organism Bos taurus
Uniprot IdQ3T0F4
Milk FractionWhey
Ref Sequence Id NP_001029888.1
Aminoacid Length 165
Molecular Weight 18898
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0F4.fasta
Gene Name RPS10
Gene Id 540965
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the 40S ribosomal subunit.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0F4|RS10_BOVIN 40S ribosomal protein S10 OS=Bos taurus OX=9913 GN=RPS10 PE=2 SV=1 MLMPKKNRIAIY*12ELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRG EADRDTYRRSAVPPGADKKAEAGAGS*146ATEFQFRGGFGRGRGQPPQ
Predicted Disorder Regions 1-6, 25-47, 88-165
DisProt Annotation
TM Helix Prediction No TM helices