Search by BoMiProt ID - Bomi3501


Primary Information

BoMiProt ID Bomi3501
Protein Name 3-ketoacyl-CoA thiolase, mitochondrial
Organism Bos taurus
Uniprot IdQ3T0R7
Milk FractionWhey
Ref Sequence Id NP_001030419.1
Aminoacid Length 397
Molecular Weight 42131
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0R7.fasta
Gene Name ACAA2
Gene Id 522006
Protein Existence Status reviewed

Secondary Information

Protein Function catalyzes the condensation of two acetyl-CoA molecules into acetoacetyl-CoA and could be involved in the production of ketone bodies. responsible for the production of acetate in a side reaction to beta-oxidation.
Significance in milk bovine mitochondrial metabolism
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0R7|THIM_BOVIN 3-ketoacyl-CoA thiolase, mitochondrial OS=Bos taurus OX=9913 GN=ACAA2 PE=2 SV=1 MALLRGVFIVAAKRTPFGAYGGLLKDFTPTDMAEFAARAALSAGRVSPETVDSVVVGNVMQSSSDAIYLARHVGLRVGIPKETPAITINRLCGSGFQSIVSGCQEICSRDSEVVLCGGT*119ES*121MSQAPY*127CVRNIRFGT*136KLGS*140ELKLEDTLWTGLTDTHVQMPMAITAENLAVKHQISREDCDRYALQSQQRWKTANDAGYFDNEMAPVEVKTRKGKQTMQVDEHPRPQTTMEQLNKLPPVFKKEGTVTAGNASGVSDGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPTIMGIGPVPAISGALKKTGLS*310LKDMDLVEVNEAFAPQYLAVEKS*333LNLDPSKTNVNGGAIALGHPLAGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIENTA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices