Search by BoMiProt ID - Bomi3484


Primary Information

BoMiProt ID Bomi3484
Protein Name 2-oxoglutarate dehydrogenase, mitochondrial/2-oxoglutarate dehydrogenase complex component E1/Alpha-ketoglutarate dehydrogenase
Organism Bos taurus
Uniprot IdQ148N0
Milk FractionWhey
Ref Sequence Id NP_001069498.1
Aminoacid Length 1023
Molecular Weight 115808
Fasta Sequence https://www.uniprot.org/uniprot/Q148N0.fasta
Gene Name OGDH
Gene Id 534599
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells heart
Protein Function Alpha-ketoglutarate dehydrogenase (alpha-KGDH) is a highly regulated enzyme, which could determine the metabolic flux through the Krebs cycle.
Biochemical Properties It catalyses the conversion of alpha-ketoglutarate to succinyl-CoA and produces NADH directly providing electrons for the respiratory chain. 
PTMs N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q148N0|ODO1_BOVIN 2-oxoglutarate dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=OGDH PE=2 SV=1 MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFGQIRCYTAPVAAEPFLSGTSSNYVEE MYYAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLPLS*100PGSLSAVARAGPLVEAQPNV DKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDES DLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFET PGVMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSEN GVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINR VTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDP EAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY AELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPR SMTCPSTGLTEDILTHIGNVASSVPVEDFTIHGGLSRILKTRGELVKNRTVDWALAEYMA FGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSL SEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLP HGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFH VLRRQILLPFRKPLIIFTPKSLLRHPEARSNFDEMLPGTHFQRVIPEDGPAAQNPGNVKR LLFCTGKVYYDLTRERKARDMVEQVAITRIEQLSPFPFDLLLQEVQKYPSAELAWCQEEH KNQGYYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDAFK NFS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Alpha-KGDH is sensitive to reactive oxygen species (ROS) and inhibition of this enzyme could be critical in the metabolic deficiency induced by oxidative stress. 
Bibliography 1.Tretter L, Adam-Vizi V. Alpha-ketoglutarate dehydrogenase: a target and generator of oxidative stress. Philos Trans R Soc Lond B Biol Sci. 2005 Dec 29;360(1464):2335-45. doi: 10.1098/rstb.2005.1764. PMID: 16321804; PMCID: PMC1569585. 2.McLain AL, Szweda PA, Szweda LI. α-Ketoglutarate dehydrogenase: a mitochondrial redox sensor. Free Radic Res. 2011 Jan;45(1):29-36. doi: 10.3109/10715762.2010.534163. Epub 2010 Nov 29. PMID: 21110783; PMCID: PMC3169906.