Search by BoMiProt ID - Bomi3480


Primary Information

BoMiProt ID Bomi3480
Protein Name 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial/AKB ligase/Aminoacetone synthase/Glycine acetyltransferase
Organism Bos taurus
Uniprot IdQ29S22
Milk FractionWhey
Ref Sequence Id NP_001039850.1
Aminoacid Length 457
Molecular Weight 50913
Fasta Sequence https://www.uniprot.org/uniprot/Q29S22.fasta
Gene Name GCAT
Gene Id 319141
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in apoptosis. May have a role in rRNA processing and mRNA splicing. Associates with pre-rRNA precursors
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus OX=9913 GN=DDX47 PE=2 SV=1 MAASVEHDS*9LESMEAPQTAVEVEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLA LQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSS IGVQCAVIVGGIDSMSQSLALAKKPHIVIAT*151PGRLIDHLENTKGFNLRALKYLVMDEADR ILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKL QQYYLFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMS QSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAG RSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQDDEVMMLTERVTEAQRFARMELREHG EKKKRS*426REDVGDNDDTEGAIGVRNKVAGGKMKKRKGR
Predicted Disorder Regions 1-20, 423-457
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Edgar, A. J., & Polak, J. M. (2000). Molecular cloning of the human and murine 2-amino-3-ketobutyrate coenzyme A ligase cDNAs. European journal of biochemistry, 267(6), 1805–1812. https://doi.org/10.1046/j.1432-1327.2000.01175.x