Search by BoMiProt ID - Bomi3468


Primary Information

BoMiProt ID Bomi3468
Protein Name 26S proteasome non-ATPase regulatory subunit 4/26S proteasome regulatory subunit RPN10
Organism Bos taurus
Uniprot IdQ58DA0
Milk FractionWhey
Ref Sequence Id NP_001013616.2
Aminoacid Length 382
Molecular Weight 41384
Fasta Sequence https://www.uniprot.org/uniprot/Q58DA0.fasta
Gene Name PSMD4
Gene Id 282016
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DA0|PSMD4_BOVIN 26S proteasome non-ATPase regulatory subunit 4 OS=Bos taurus OX=9913 GN=PSMD4 PE=2 SV=1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIAT*250AGT*253EDS*256DDALLKMTIS266QQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADMDASSAMDTSEPTKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGS*358LAS*361QATKDGKKDKKEEDKKEEDKK
Predicted Disorder Regions 165-175, 215-350, 359-382
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166