Search by BoMiProt ID - Bomi3449


Primary Information

BoMiProt ID Bomi3449
Protein Name 12S rRNA N4-methylcytidine methyltransferase/ 12S rRNA m4C methyltransferase/Methyltransferase 5 domain-containing protein 1/Methyltransferase-like protein 15
Organism Bos taurus
Uniprot IdA0JN95
Milk FractionWhey
Ref Sequence Id NP_001073250.1
Aminoacid Length 407
Molecular Weight 45768
Fasta Sequence https://www.uniprot.org/uniprot/A0JN95.fasta
Gene Name METTL15/METT5D1
Gene Id 533987
Protein Existence Status reviewed

Secondary Information

Protein Function METTL15 is required for mitochondrial function, delineate the evolution of methyltransferase substrate specificities and modification patterns in rRNA, and highlight a differential impact of m4C methylation on prokaryotic ribosomes and eukaryotic mitochondrial ribosomes.
Biochemical Properties METTL15 is a member of the methytransferase like (METTL) family, characterized by the presence of a binding domain for S-adenosyl methionine, which is a methyl-group donor for methylation reactions
PTMs Phosphorylation at Ser,Omega-N-methylation at Arginine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JN95|MET15_BOVIN 12S rRNA N4-methylcytidine methyltransferase OS=Bos taurus OX=9913 GN=METTL15 PE=2 SV=1 MLRYPYFCRIHKNFLSCWLESGIYNLGVWPKKIHATAERYNEYEAQEETDQTGIQELHRS QDRDSGVMTKLHIPVMVDEVVRCLAPQKGQVFLDMTFGSGGHTRAILQKEPDITLYALDR DPTAYAIAEQLSELYPKQIRAILGQFSQAEALLMKAGVQPGTLDGVLLDLGCSSMQLDTP ERGFSLRKDGPLDMRMDGDRYPDMPTAADVVNALDQQALASILRAYGEEKHAKKIASAII QARGLYPITRTQQLASIVAGAFPPSALYARKDLLQRPTHIATKTFQAFRIFVNNELNELY TGLKTAQKFLRPGGHLVALSFHSLEDRIIKRFLLGISMTERFNLSARQKVIQKSQLDS*358DQ ENKEGVSTGKAPLMWKLIHKKVLTPEDEDVQDNPRGRSAKLRAAIKL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments METTL15 depletion results in impaired translation of mitochondrial protein-coding mRNAs and decreases mitochondrial respiration capacity.
Bibliography 1.Chen H, Shi Z, Guo J, Chang KJ, Chen Q, Yao CH, Haigis MC, Shi Y. The human mitochondrial 12S rRNA m4C methyltransferase METTL15 is required for mitochondrial function. J Biol Chem. 2020 Jun 19;295(25):8505-8513. doi: 10.1074/jbc.RA119.012127. Epub 2020 May 5. PMID: 32371392; PMCID: PMC7307190.