Primary Information |
---|
BoMiProt ID | Bomi3449 |
---|
Protein Name | 12S rRNA N4-methylcytidine methyltransferase/
12S rRNA m4C methyltransferase/Methyltransferase 5 domain-containing protein 1/Methyltransferase-like protein 15 |
---|
Organism | Bos taurus |
---|
Uniprot Id | A0JN95 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001073250.1 |
---|
Aminoacid Length | 407 |
---|
Molecular Weight | 45768 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A0JN95.fasta |
---|
Gene Name | METTL15/METT5D1 |
---|
Gene Id | 533987 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | METTL15 is required for mitochondrial function, delineate the evolution of methyltransferase substrate specificities and modification patterns in rRNA, and highlight a differential impact of m4C methylation on prokaryotic ribosomes and eukaryotic mitochondrial ribosomes. |
---|
Biochemical Properties | METTL15 is a member of the methytransferase like (METTL) family, characterized by the presence of a binding domain for S-adenosyl methionine, which is a methyl-group donor for methylation reactions |
---|
PTMs | Phosphorylation at Ser,Omega-N-methylation at Arginine |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JN95|MET15_BOVIN 12S rRNA N4-methylcytidine methyltransferase OS=Bos taurus OX=9913 GN=METTL15 PE=2 SV=1
MLRYPYFCRIHKNFLSCWLESGIYNLGVWPKKIHATAERYNEYEAQEETDQTGIQELHRS
QDRDSGVMTKLHIPVMVDEVVRCLAPQKGQVFLDMTFGSGGHTRAILQKEPDITLYALDR
DPTAYAIAEQLSELYPKQIRAILGQFSQAEALLMKAGVQPGTLDGVLLDLGCSSMQLDTP
ERGFSLRKDGPLDMRMDGDRYPDMPTAADVVNALDQQALASILRAYGEEKHAKKIASAII
QARGLYPITRTQQLASIVAGAFPPSALYARKDLLQRPTHIATKTFQAFRIFVNNELNELY
TGLKTAQKFLRPGGHLVALSFHSLEDRIIKRFLLGISMTERFNLSARQKVIQKSQLDS*358DQ
ENKEGVSTGKAPLMWKLIHKKVLTPEDEDVQDNPRGRSAKLRAAIKL
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | METTL15 depletion results in impaired translation of mitochondrial protein-coding mRNAs and decreases mitochondrial respiration capacity. |
---|
Bibliography | 1.Chen H, Shi Z, Guo J, Chang KJ, Chen Q, Yao CH, Haigis MC, Shi Y. The human mitochondrial 12S rRNA m4C methyltransferase METTL15 is required for mitochondrial function. J Biol Chem. 2020 Jun 19;295(25):8505-8513. doi: 10.1074/jbc.RA119.012127. Epub 2020 May 5. PMID: 32371392; PMCID: PMC7307190. |