Search by BoMiProt ID - Bomi3448


Primary Information

BoMiProt ID Bomi3448
Protein Name 116 kDa U5 small nuclear ribonucleoprotein component/Elongation factor Tu GTP-binding domain protein 2/U5 snRNP-specific protein, 116 kDa/U5-116 kDa
Organism Bos taurus
Uniprot IdA4FUD3
Milk FractionWhey
Ref Sequence Id NP_001076865.1
Aminoacid Length 972
Molecular Weight 109386
Fasta Sequence https://www.uniprot.org/uniprot/A4FUD3.fasta
Gene Name EFTUD2/SNRP116
Gene Id 509425
Protein Existence Status reviewed

Secondary Information

Protein Function Required for pre-mRNA splicing as component of the spliceosome amd it recognizes the 3' splice site for catalytic step II in mammals.
Biochemical Properties 116 kDa protein of human U5 snRNPs (U5-116kD) is closely related to the eukaryotic ribosomal translocase.Sequence elements typical of the GTPase superfamily of U5-116kD contains the consensus proteins that bind and hydrolyze GTP.Homologs of U5-116kD have been also identified in yeast (Snu114p) and nematodes and mouse.
PTMs N-Acetylation Meth, Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus OX=9913 GN=EFTUD2 PE=2 SV=1 MDTDLYDEFGNYIGPELDS*19DEDDDELGRETKDLDEVDEDEDDDDVGDHDEDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDT*86QPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDSLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM
Predicted Disorder Regions (1-77)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Early in mammalian spliceosome assembly, U2AF65 binds to the pyrimidine tract between the BPS and AG. U2AF65 crosslinking is replaced by crosslinking of three proteins of 110, 116 and 220 kDa prior to catalytic step II, and it provides the evidence that all three proteins are components of U5 snRNP. 
Bibliography 1.Fabrizio P, Laggerbauer B, Lauber J, Lane WS, Lührmann R. An evolutionarily conserved U5 snRNP-specific protein is a GTP-binding factor closely related to the ribosomal translocase EF-2. EMBO J. 1997 Jul 1;16(13):4092-106. doi: 10.1093/emboj/16.13.4092. PMID: 9233818; PMCID: PMC1170032. 2.Chiara MD, Palandjian L, Feld Kramer R, Reed R. Evidence that U5 snRNP recognizes the 3' splice site for catalytic step II in mammals. EMBO J. 1997 Aug 1;16(15):4746-59. doi: 10.1093/emboj/16.15.4746. PMID: 9303319; PMCID: PMC1170101.