Primary Information |
---|
BoMiProt ID | Bomi3448 |
---|
Protein Name | 116 kDa U5 small nuclear ribonucleoprotein component/Elongation factor Tu GTP-binding domain protein 2/U5 snRNP-specific protein, 116 kDa/U5-116 kDa |
---|
Organism | Bos taurus |
---|
Uniprot Id | A4FUD3 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001076865.1 |
---|
Aminoacid Length | 972 |
---|
Molecular Weight | 109386 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/A4FUD3.fasta |
---|
Gene Name | EFTUD2/SNRP116 |
---|
Gene Id | 509425 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Required for pre-mRNA splicing as component of the spliceosome amd it recognizes the 3' splice site for catalytic step II in mammals. |
---|
Biochemical Properties | 116 kDa protein of human U5 snRNPs (U5-116kD) is closely related to the eukaryotic ribosomal translocase.Sequence elements typical of the GTPase superfamily of U5-116kD contains the consensus proteins that bind and hydrolyze GTP.Homologs of U5-116kD have been also identified in yeast (Snu114p) and nematodes and mouse. |
---|
PTMs | N-Acetylation Meth, Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation formation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus OX=9913 GN=EFTUD2 PE=2 SV=1
MDTDLYDEFGNYIGPELDS*19DEDDDELGRETKDLDEVDEDEDDDDVGDHDEDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDT*86QPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDSLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM
|
---|
Predicted Disorder Regions | (1-77) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Early in mammalian spliceosome assembly, U2AF65 binds to the pyrimidine tract between the BPS and AG. U2AF65 crosslinking is replaced by crosslinking of three proteins of 110, 116 and 220 kDa prior to catalytic step II, and it provides the evidence that all three proteins are components of U5 snRNP. |
---|
Bibliography | 1.Fabrizio P, Laggerbauer B, Lauber J, Lane WS, Lührmann R. An evolutionarily conserved U5 snRNP-specific protein is a GTP-binding factor closely related to the ribosomal translocase EF-2. EMBO J. 1997 Jul 1;16(13):4092-106. doi: 10.1093/emboj/16.13.4092. PMID: 9233818; PMCID: PMC1170032. 2.Chiara MD, Palandjian L, Feld Kramer R, Reed R. Evidence that U5 snRNP recognizes the 3' splice site for catalytic step II in mammals. EMBO J. 1997 Aug 1;16(15):4746-59. doi: 10.1093/emboj/16.15.4746. PMID: 9303319; PMCID: PMC1170101. |