Search by BoMiProt ID - Bomi3446


Primary Information

BoMiProt ID Bomi3446
Protein Name 10 kDa heat shock protein, mitochondrial/Chaperonin 10/
Organism Bos taurus
Uniprot IdP61603
Milk FractionWhey
Ref Sequence Id NP_776771.1
Aminoacid Length 102
Molecular Weight 10932
Fasta Sequence https://www.uniprot.org/uniprot/P61603.fasta
Gene Name HSPE1
Gene Id 281833
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells adrenal gland
Protein Function Cpn10 is a heat shock protein that functions as a molecular chaperone. It binds to and stabilizes cpn60 and these molecules mediate protein folding in mitochondria, chloroplasts and bacteria. Extracellular chaperonin 10 augments apoptotic cell death induced by 5-fluorouracil in human colon cancer cells.
Biochemical Properties Homoheptamer arranged in a ring structure. 2 heptameric Hsp10 rings interact with a Hsp60 tetradecamer in the structure of a back-to-back double heptameric ring to form the symmetrical football complex.It's predicted protein sequence differs from rat at residue number 52 where Gly is replaced by Ser.Aminoacid sequence is 63% identical to rat.
PTMs N-Acetylation at Ala, Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P61603|CH10_BOVIN 10 kDa heat shock protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPE1 PE=3 SV=2 MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGT79*KVVLDDKDYFLFRDGDILGKYVD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Kim K, Yeo SG. Extracellular chaperonin 10 augments apoptotic cell death induced by 5-fluorouracil in human colon cancer cells. Tumori. 2014 Nov-Dec;100(6):e230-5. doi: 10.1700/1778.19282. PMID: 25688504. 2.Cavanagh AC. Identification of early pregnancy factor as chaperonin 10: implications for understanding its role. Rev Reprod. 1996 Jan;1(1):28-32. doi: 10.1530/ror.0.0010028. PMID: 9414435.