Search by BoMiProt ID - Bomi338


Primary Information

BoMiProt ID Bomi338
Protein Name CD38 molecule
Organism Bos taurus
Uniprot IdQ9TTF5
Milk FractionExosome
Ref Sequence Id NP_786992.1
Amino Acid Lenth 278
Molecular Weight 31546
Fasta Sequence https://www.uniprot.org/uniprot/Q9TTF5.fasta
Gene Name CD38
Gene Id 327677
Protein Existence Status Unreviewed: Experimental evidence at protein level

Secondry Information

Protein Function human CD38 -transmembrane glycoprotein involved in lymphocyte activation and adhesion to endothelium; implicated in activities typical of cell surface receptors, such as signaling for activation and proliferation events and heterotypic cell adhesion; involved in the regulation of intracellular calcium levels in several cell systems
Biochemical Properties ectocellular domain of the molecule possesses properties of a bifunctional enzyme catalyzing both the synthesis from NAD+ and the hydrolysis of the calcium-releasing metabolite cyclic ADP-ribose;
PTMs Glycosylated: potential N-linked glycosylation sites asparagine residues, N100, N164, N209 and N219
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>tr|Q9TTF5|Q9TTF5_BOVIN CD38 molecule OS=Bos taurus OX=9913 GN=CD38 PE=1 SV=1
MADCCTPRKKLCWCVLLFFLVAGITGGAIGIYKWHYSGLNRWHGAGSTADFQKIIQERCD TYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSK TKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVF WEVLSERFAESACNTVRVVLN*201GSLENAFDSMSIFGRVE*218APNLRPQVELEAWLVHDTGKPP SDSCSGSSIRKLKSILDGRNVKFRCMDNLSRDQFLQRS
Significance of PTMs ADP-ribosyl cyclase activity of CD38 showed a decrease in the Vmax following its treatment with N-glycosidase F , the extracellular non-glycosylated form of CD38 was still fully active and exhibited both cyclase and hydrolase activities; Glycosylation prevents CD38 protein from forming inter-molecular cross-links
PDB ID 3GC6, 3GH3, 3GHH, 3KOU, 3P5S,
Bibliography 1. Gao, Y. and Mehta, K. (2007) ‘N-linked glycosylation of CD38 is required for its structure stabilization but not for membrane localization’, Molecular and Cellular Biochemistry, 295(1–2), pp. 1–7. doi: 10.1007/s11010-006-9265-9.
2. Fumaro, A. et al. (1996) ‘Identification and characterization of an active soluble form of human CD38 in normal and pathological fluids’, International Immunology. Narnia, 8(11), pp. 1643–1650. doi: 10.1093/intimm/8.11.1643.