Search by BoMiProt ID - Bomi32


Primary Information

BoMiProt ID Bomi32
Protein Name Fetuin
Organism Bos taurus
Uniprot IdQ58D62
Milk FractionWhey
Ref Sequence Id NP_001029390.1
Amino Acid Lenth 387
Molecular Weight 42663
Fasta Sequence https://www.uniprot.org/uniprot/Q58D62.fasta
Gene Name FETUB
Gene Id 504615
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells Identified primarily in blood and brain
Protein Function member of the cystatin superfamily; identified as major proteins during fetal life; mRNAlevel is down-regulated during the acute phase of experimentally induced inflammation in rat; opsonize cationic macrophage-deactivating molecules;
Biochemical Properties homologous to fetuin-A structurally; Nonspecific hydrophobic interactions were supposed to play a central role in maintaining a hydrophobic core, around which are held together the secondary structural elements and the fluctuating side chains of the protein; potential stabilizing factor for the stability of the molten globule state of BSF is the presence of disulfide bonds
Significance in milk Involved in host defence related responses in bovine milk during an experimentally induced Streptococcus uberis infection
PTMs complex triantennary oligosaccharides; possesses considerable N-glycosylation site heterogeneity; asialo-fetuin contains two variant triantennary oligosaccharides with either Galß(l - 3)^3 or Galß(1 - 4) at one of the terminal branch positions; presence of sialylation heterogeneity among each of these oligosaccharides; contains 12 cysteines and makes 6 disulfide bonds
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58D62|FETUB_BOVIN Fetuin-B OS=Bos taurus OX=9913 GN=FETUB PE=1 SV=1
MNVLLLLVLCTLAMGCGATSPPQPAARPSSLLSLDCNSSYVLDIANDILQDINRDRKDGY VLSLNRVSDAREHRQEAGLGSLFYFTLDVLETGCHVLSRTSWKNCEVRIFHESVYGQCKA IFYINKEKRIFYLPAYNCTLRPVSQSAIIMTCPDCPSTSPYDLSNPRFMETATESLAKYN SESPSKQYSLVKITKTSSQWVFGPAYFVEYLIKESPCVKSEGSSCALESPGSVPVGICHG SLGEPQGNQGKIISVTCSFFNSQAPTPRGENATVNQRPANPSKTEELQQQNT*292APT*295NSPTK AVPKGSVQYLPDWDKKREGSQEKDPVETFPVQLDLTTNPQGESLDVSFLFQEPMEEKVVV LPFPSKEQRSAECPGPAQKGYPFILPS
Additional Comments the fetuin family encompasses a series of tightly related proteins that are synthesized mostly in the liver and have been variably designated fetuin in sheep, pig and cow, a2-HS-glycoprotein (AHSG) in human, phosphoprotein of 63 kDa (pp63) in rat, or countertrypin in mouse and gerbil
Bibliography 1. Rice, K. G., Rao, N. B. N., & Lee, Y. C. (1990). Large-scale preparation and characterization of N-linked glycopeptides from bovine fetuin. Analytical Biochemistry, 184(2), 249–258. https://doi.org/10.1016/0003-2697(90)90676-Z.
2. Smolenski, G. A., Broadhurst, M. K., Stelwagen, K., Haigh, B. J., & Wheeler, T. T. (2014). Host defence related responses in bovine milk during an experimentally induced Streptococcus uberis infection. Proteome Science, 12(1). https://doi.org/10.1186/1477-5956-12-19.
3. Olivier, E., Soury, E., Ruminy, P., Husson, A., Parmentier, F., Daveau, M., & Salier, J. P. (2000). Fetuin-B, a second member of the fetuin family in mammals. The Biochemical Journal, 350 Pt 2, 589–597. Retrieved from http://www.ncbi.nlm.nih.gov/pubmed/10947975.
4 Wang, C., Lascu, I., & Giartosio, A. (1998). Bovine serum fetuin is unfolded through a molten globule state. Biochemistry, 37(23), 8457–8464. https://doi.org/10.1021/bi9723010.