Search by BoMiProt ID - Bomi286


Primary Information

BoMiProt ID Bomi286
Protein Name Coagulation factor IX (Fragment)
Organism Bos taurus
Uniprot IdP00741
Milk FractionWhey
Amino Acid Lenth 462
Molecular Weight 52046
Fasta Sequence https://www.uniprot.org/uniprot/P00741.fasta
Gene Name F9
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Protein Function plasma glycoprotein which participates in the middle phase of intrinsic blood coagulation; During coagulation, factor IX is converted to an enzyme, factor IX;l, by factor XIa- Factor IXa then converts factor X (Stuart factor) to factor Xa in the presence of factor VIII
Biochemical Properties single polypeptide chain with an amino-terminal sequence of Tyr-Asn-Ser-Gly; isoelectric point is 3.7; binds to Dextran Blue in the presence of calcium ions; susceptible to minor protease degradation by plasma enzymes
PTMs Glycosylated: contains approximately 26% carbohydrate which includes 10.6% hexose, 6.5% V-acetylhexosamine, and 8.7% V-acetyIncuraminic acid;
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P00741|FA9_BOVIN Coagulation factor IX OS=Bos taurus OX=9913 GN=F9 PE=1 SV=2
MWCLNMIMAESPGLVTICLLGYLLSAECTVFLDRENATKILHRPKRYNSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCES*99NPCLNGGMCKDDINSYECWCQAGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAEDQKSCEPAVPFPCGRVSVSHISKKLTRAETIFSNTNYEN*204SSEAEIIWDN*214VTQSN*219QSFDEFSRVVGGEDAERGQFPWQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRAIPYHSYN*307ASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKVFNRGRSASILQYLKVPLVDRATCLRSTKFIYSHMFCAGYHEGGKDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Significance of PTMs high carbohydrate content of factor IX, a carbohydrate heparin interaction bridged by calcium ions is possible
PDB ID 1J34, 1J35,
Bibliography 1. Fujikawa, K. et al. (1973) ‘Isolation and characterization of bovine factor IX (Christmas factor)’, Biochemistry, 12(24), pp. 4938–4945. doi: 10.1021/bi00748a019.
2. Fujikawa, K. et al. (1974) ‘Mechanism of activation of bovine factor IX (Christmas factor) by bovine factor XIa(activated plasma thromboplastin antecedent)’, Biochemistry, 13(22), pp. 4508–4516. doi: 10.1021/bi00719a006.