Search by BoMiProt ID - Bomi232


Primary Information

BoMiProt ID Bomi232
Protein Name Beta-1,4-galactosyltransferase 1
Organism Bos taurus
Uniprot IDP08037
Milk FractionWhey, MFGM, Exosome
Ref Sequence ID NP_803478.1
Aminoacid Length 402
Molecular Weight 44843
FASTA Sequence Download
Gene Name B4GALT1
Gene ID 281781
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondary Information

Protein Function synthesizes a disaccharide unit, Galβ1-4GlcNAc (N-acetyllactosamine), present in many biologically active carbohydrate determinants, mediating several biological events, making it a key enzyme in glycobiology; participates in the synthesis of Galβ1-4-GlcNacdisaccharide unit of glycoconjugates. Lactosylceramide and paragloboside were synthesized from their precursor glycolipids and UDP-galactose by lactose synthase A protein.
Biochemical Properties trans-Golgi glycosyltransferase (Glyco-T) with a type II membrane protein topology, a short N-terminal cytoplasmic domain, a membrane-spanning region, as well as a stem and a C-terminal catalytic domain facing the trans-Golgi-lumen; hydrophobic membrane-spanning region, like that of other Glyco-T, has a shorter length compared to plasma membrane proteins, an important feature for its retention in the trans-Golgi;
Significance in milk interacts with α-lactalbumin to form the lactose synthase (LS) complex that transfers galactose from UDP-α-D-Gal to glucose, producing the lactose secreted in milk
PTMs Disulfide bond formation and Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P08037|B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL QGSSHGAAAIGQPSGELRLRGVAPPPPLQN*90SSKPRSRAPSNLDAYSHPGPGPGPGSNLTS APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
SCOP Class : Alpha and beta proteins (a/b)
Fold : NDP Glycotransferase-like
Superfamily : Nucleotide-diphospho-sugar transferases
Family : beta 1,4 galactosyltransferase (b4GalT1)
Domain Name : 1NMM B:131-402

CATH Matched CATH superfamily
3.90.550.10
Predicted Disorder Regions (58-136)
DisProt Annotation
TM Helix Prediction 1TMH; (25-43)
PDB ID 1FGX, 1FR8, 1NF5, 1NHE, 1NKH, 1NMM, 1NQI, 1NWG, 1O0R, 1O23, 1OQM, 1PZT, 1PZY, 1TVY, 1TW1, 1TW5, 1YRO, 2FYC, 2FYD, 4KRV,
Bibliography 1. Qasba, P. K., Ramakrishnan, B. and Boeggeman, E. (2005) ‘Substrate-induced conformational changes in glycosyltransferases’, Trends in Biochemical Sciences, 30(1), pp. 53–62. doi: 10.1016/j.tibs.2004.11.005.
2. Qasba, P., Ramakrishnan, B. and Boeggeman, E. (2008) ‘Structure and Function of β -1,4-Galactosyltransferase’, Current Drug Targets, 9(4), pp. 292–309. doi: 10.2174/138945008783954943.
3. Harrus, D. et al. (2018) ‘The dimeric structure of wild-type human glycosyltransferase B4GalT1.’, PloS one. Edited by I. André, 13(10), p. e0205571. doi: 10.1371/journal.pone.0205571. 4.Yamato K, Yoshida A. Biosynthesis of lactosylceramide and paragloboside by human lactose synthase A protein. J Biochem. 1982 Oct;92(4):1123-7. doi: 10.1093/oxfordjournals.jbchem.a134028. PMID: 6816790.