Search by BoMiProt ID - Bomi232


Primary Information

BoMiProt ID Bomi232
Protein Name Beta-1,4-galactosyltransferase 1
Organism Bos taurus
Uniprot IdP08037
Milk FractionWhey, MFGM, Exosome
Ref Sequence Id NP_803478.1
Amino Acid Lenth 402
Molecular Weight 44843
Fasta Sequence https://www.uniprot.org/uniprot/P08037.fasta
Gene Name B4GALT1
Gene Id 281781
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Protein Function synthesizes a disaccharide unit, Galβ1-4GlcNAc (N-acetyllactosamine), present in many biologically active carbohydrate determinants, mediating several biological events, making it a key enzyme in glycobiology; participates in the synthesis of Galβ1-4-GlcNacdisaccharide unit of glycoconjugates;
Biochemical Properties trans-Golgi glycosyltransferase (Glyco-T) with a type II membrane protein topology, a short N-terminal cytoplasmic domain, a membrane-spanning region, as well as a stem and a C-terminal catalytic domain facing the trans-Golgi-lumen; hydrophobic membrane-spanning region, like that of other Glyco-T, has a shorter length compared to plasma membrane proteins, an important feature for its retention in the trans-Golgi;
Significance in milk interacts with α-lactalbumin to form the lactose synthase (LS) complex that transfers galactose from UDP-α-D-Gal to glucose, producing the lactose secreted in milk
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P08037|B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL QGSSHGAAAIGQPSGELRLRGVAPPPPLQN*90SSKPRSRAPSNLDAYSHPGPGPGPGSNLTS APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
PDB ID 1FGX, 1FR8, 1NF5, 1NHE, 1NKH, 1NMM, 1NQI, 1NWG, 1O0R, 1O23, 1OQM, 1PZT, 1PZY, 1TVY, 1TW1, 1TW5, 1YRO, 2FYC, 2FYD, 4KRV,
Bibliography 1. Qasba, P. K., Ramakrishnan, B. and Boeggeman, E. (2005) ‘Substrate-induced conformational changes in glycosyltransferases’, Trends in Biochemical Sciences, 30(1), pp. 53–62. doi: 10.1016/j.tibs.2004.11.005.
2. Qasba, P., Ramakrishnan, B. and Boeggeman, E. (2008) ‘Structure and Function of β -1,4-Galactosyltransferase’, Current Drug Targets, 9(4), pp. 292–309. doi: 10.2174/138945008783954943.
3. Harrus, D. et al. (2018) ‘The dimeric structure of wild-type human glycosyltransferase B4GalT1.’, PloS one. Edited by I. André, 13(10), p. e0205571. doi: 10.1371/journal.pone.0205571.