Search by BoMiProt ID - Bomi2098


Primary Information

BoMiProt ID Bomi2098
Protein Name Fibroblast growth factor-binding protein 1
Organism Bos taurus
Uniprot IdQ9MZ06
Milk FractionWhey, Exosome
Ref Sequence Id NP_776762.1
Aminoacid Length 234
Molecular Weight 26188
Fasta Sequence https://www.uniprot.org/uniprot/Q9MZ06.fasta
Gene Name FGFBP1
Gene Id 281812
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondary Information

Protein Function FGF-BP1 is an extracellular matrix bound protein that enhances fibroblast growth factor (FGF) signaling.
Biochemical Properties A novel element in the region from -785 to -782 bp of the FGF-BP1 promoter, which represents a known binding site for Hypermethylation in Cancer-1 (Hic-1), necessary for repression of FGF-BP1 by TGF-beta.
PTMs Disulfide bond formation, N-Linked and O-Linked Glycosylation at Asn and Ser respectively
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9MZ06|FGFP1_BOVIN Fibroblast growth factor-binding protein 1 OS=Bos taurus OX=9913 GN=FGFBP1 PE=1 SV=1
MRTHGLTLLSLLLLAVPMLLVEAKKEGRNRRGSKASADESLALGKPGKEPRSQPTNYPIK GKFVTPDHADCRWAVTKQEEGIVLKVECTQRDNTFSCFFTGNPTSCLELHKNNAYWKQIG RNLRSQKVICGDAKSVLKTRVCRKKFPESNLKLVN*155STLIRIKKPSQELMEPS*172PMDTVEVT TSSSPEKTQTMATKDPQCEEEDLKNQRKAALEYCGETWGSLCNFFLSMVQGSSC
Predicted Disorder Regions 25-59,169-200
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Briones VR, Chen S, Riegel AT, Lechleider RJ. Mechanism of fibroblast growth factor-binding protein 1 repression by TGF-beta. Biochem Biophys Res Commun. 2006 Jun 30;345(2):595-601. doi: 10.1016/j.bbrc.2006.04.052. Epub 2006 Apr 25. PMID: 16690027.