Search by BoMiProt ID - Bomi2098


Primary Information

BoMiProt ID Bomi2098
Protein Name Fibroblast growth factor-binding protein 1
Organism Bos taurus
Uniprot IdQ9MZ06
Milk FractionWhey, Exosome
Ref Sequence Id NP_776762.1
Amino Acid Lenth 234
Molecular Weight 26188
Fasta Sequence https://www.uniprot.org/uniprot/Q9MZ06.fasta
Gene Name FGFBP1
Gene Id 281812
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells Detected in the digestive system, thymus, skin, hair, follicles, dental germ, respiratory tract, various glandular tissues, kidney and liver
Protein Function Secreted chaperones known to bind and mobilize paracrine FGFs from their heparan sulfate (HS) storage in the extracellular matrix; modulate FGF functions during development, tumorigenesis, tissue homeostasis and tissue repair;
Biochemical Properties cDNA sequence predicts that the unprocessed bovine FGF-BP is 234 residues long - equivalent to the human counterpart; signal peptidase would cleave between residues 23 and 24 during the secretion process, resulting in Lys24 at the N terminus. Nevertheless, the predominant forms of the purified protein observed in the present study started at Gly32 and Ser52, respectively; both are heparin-binding proteins with similar molecular sizes (36–37 kDa) and pI values (9.0–9.1); the N-terminal amino acid of both proteins is lysine
Significance in milk All cysteine residues of bovine FGF-BP are involved in disulfide bonds, suggesting that the maintenance of tertiary structure of FGF-BP in bovine prepartum mammary gland secretion
PTMs glycosylation sites revealed the presence of glycans on Asn155 and Ser172
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9MZ06|FGFP1_BOVIN Fibroblast growth factor-binding protein 1 OS=Bos taurus OX=9913 GN=FGFBP1 PE=1 SV=1
MRTHGLTLLSLLLLAVPMLLVEAKKEGRNRRGSKASADESLALGKPGKEPRSQPTNYPIK GKFVTPDHADCRWAVTKQEEGIVLKVECTQRDNTFSCFFTGNPTSCLELHKNNAYWKQIG RNLRSQKVICGDAKSVLKTRVCRKKFPESNLKLVN*155STLIRIKKPSQELMEPS*172PMDTVEVT TSSSPEKTQTMATKDPQCEEEDLKNQRKAALEYCGETWGSLCNFFLSMVQGSSC
Bibliography 1. Lametsch R, Rasmussen JT, Johnsen LB, Purup S, Sejrsen K, Petersen TE, et al. Structural characterization of the fibroblast growth factor-binding protein purified from bovine prepartum mammary gland secretion. J Biol Chem. 2000 Jun 30;275(26):19469–74.
2. Kawakami A, Hirayama K, Kawakami F, Kawakami H, Fujihara M, Ohtsuki K. Purification and biochemical characterization of a fibroblast growth factor-binding protein (FGF-BP) from the lactoferrin fraction of bovine milk. Biochim Biophys Acta - Gen Subj. 2006 Mar;1760(3):421–31.