Search by BoMiProt ID - Bomi159


Primary Information

BoMiProt ID Bomi159
Protein Name Alpha-2-macroglobulin
Organism Bos taurus
Uniprot IdQ7SIH1
Milk FractionWhey
Ref Sequence Id NP_001103265.1
Amino Acid Lenth 1510
Molecular Weight 167576
Fasta Sequence http://www.uniprot.org/uniprot/Q7SIH1.fasta
Gene Name A2M
Gene Id 513856
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells Serum, plasma, inflammatory synovial fluid, cerebrospinal fluid, saliva, urine
Protein Function Protease inhibitory activity; inhibits the excessive protease activity in the human body fluids, plays an important role in regulation of hormones, growth factors and physiological activity;
Biochemical Properties Presence of a special bait region is responsible for trapping proteases and inhibiting their activities by steric hindrance; protease inhibitory activity was reduced to 25% and 2.7% at 60°C and 80°C; low at pH 7.0 or below and high at pH 9.0;
Significance in milk Acute phase proteins; levels elevate in mastitic milk; prevents clotting of mastitic milk by inhibiting renin
PTMs Glycosylayted; 4 identical subunits have 8-N glycosylated sites in each subunit as found in humans;
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q7SIH1|A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
MGKNKLLYPSLTLLLLLLLPTDASVSGKPQYMVLVPSLLHTETPEKGCLLLSHLNETVTV SASLESVRENRSLFTDVVAEKDLFHCVSFTLPRSPTSQEVMFLTIQVKGPTQEFKKRTTV LVKNEESLVFVQTDKPIYKPEQTVKFRIVLLDESFHPLNELVPLVYVEDPKGNRIAQWQN LEVENGLQQLTFPLSSEPFQGSYKVVVQKGSGGTAEHPFTVEEFVLPKFEVQVRMPKIIT ILEEEVQVSVCGLYTYGKPVPGRVTMNMCRKYRNPSNCYGEESNAVCEKFSGELNNEGCF SQQVNTKIFQLKRQEFEMKIEVEAKIQEEGTEVELTGKGATEITTTITKLSFVTVDSNLR RGIPFTGKVLLVDGKGVPMPNKVIFITANEANHNSNTTTDEHGLAQFSITTTKIKGTSLS IRVKYKDHSPCYGYQWLSEEHQDAYHSANLVFSRSNSFVYLEPLPRELPCGKTQTVQAHY VLKGQVLKDLKELVFYYLIMAKGGIVRSGTHTLPVEQGDMQGHFSMSVPVESDIAPVARL LIYAILPDGEVVGDSARYEIEHCLANKVGLNFSPGQSFPASQAHLRVTASPQSLCALRAV DQSVLLMRPEAELSAATVYNLLPVKDLSSFPSSVNQQEEDNEDCISHDNVYINGIMYFPV SNTNEKDMYSFLQDMGLKAFTNSKIHKPKICPQPEEHRIQHHTLLASPVRAEMGRNRDFV HFDDTSEPPTETVRKYFPETWIWDLVVVSSSGVHEVEVTVPDTITEWKAGALCLSRDTGL GLSPTASLRVFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVP EKEQETYCICGNGRQTVSWAVTPKSLGNVNFTVSAEAVESQELCGSEVPVVPEHGRKDTI IKPLLVEPEGLEKEVIFNSLLCPSVDFVFLGAEDGGQVLRHFPPAAATDTAADAHDPARP GAKVSESLSLKLPPNVVEESARASFSVLGDILGSAMRNTQNLLQMPYGCGEQNMARFAPN IYVLDYLNETQQLTAELKSKAILYLNTGYQRQLLYKHFDGSYSTFGEHRGNSEGNTWLTA FVLKSFAQARGYIFIDEAHITEALTWLAQKQKSNGCFRSTGTLLNNAIKGGVDDEVTLSA YITIALLEMPLPVTHPVVRNALFCLDSAWKSAKEGSQGSHVYTKALLAYAFALAGNQERR TEVLTSLYEEAVKEDNTIHWTRPQKPRLLTEDIYQPRAPSAEVEMTAYVILAHVTAQPAP NPEDLKRATSIVKWISKQQNCQGGFSSTQDTVVALHALSRYGAATFTSARKAAQVTIQSS GTFSTKFQVENSNRLLLQQVSLPEVPGEYSMSVTGEGCVYLQTSLKYNILPKKDEFPFAL EVQTLPQTCDGPKAHTSFQISLSVSYIGSRPASNMAIVDVKMVSGFIPLKPTVKMLERSN*1440 VSRTEVSNNHVLIYLDKVTNETLTLTFTVLQDIPVRDLKPAIVKVYDYYETDEFAVAEYS APCSKDIGNA
PDB ID 1ayo,
Bibliography 1. Perez, M. D., Sanchez, L., Aranda, P., Sala, F. J., and Calvo, M. (1989) Time-course levels of alpha 2-macroglobulin and albumin in cow colostrum and milk and alpha 2-macroglobulin levels in mastitic cow milk. Ann. Rech. Vet. 20, 251–258.
2. 1. Chuang, W.-H., Liu, P.-C., Hung, C.-Y., and Lee, K.-K. (2014) Purification, characterization and molecular cloning of alpha-2-macroglobulin in cobia, Rachycentron canadum. Fish Shellfish Immunol. 41, 346–355.
3. 1. Paiva, M. M., Soeiro, M. N. C., Barbosa, H. S., Meirelles, M. N. L., Delain, E., and Araújo-Jorge, T. C. (2010) Glycosylation patterns of human alpha2-macroglobulin: Analysis of lectin binding by electron microscopy. Micron 41, 666–673.
4. 1. Buresova, V., Hajdusek, O., Franta, Z., Sojka, D., and Kopacek, P. (2009) IrAM—An α2-macroglobulin from the hard tick Ixodes ricinus: Characterization and function in phagocytosis of a potential pathogen Chryseobacterium indologenes. Dev. Comp. Immunol. 33, 489–498.
5. 1. Sheikh, A. M., Chauhan, V., Tsiouris, J. A., Mehta, P. D., Burguess, K., Fenko, M. D., Spivack, W., Vaughan, M., and Malik, M. (2003) Elevated levels of serum alpha(2) macroglobulin in wild black bears during hibernation. Biochimie 85, 1027–1032.