Search by BoMiProt ID - Bomi113


Primary Information

BoMiProt ID Bomi113
Protein Name Butyrophilin subfamily 1 member A1
Organism Bos taurus
Uniprot IdP18892
Milk FractionWhey
Ref Sequence Id NP_776933.1
Amino Acid Lenth 526
Molecular Weight 59277
Fasta Sequence https://www.uniprot.org/uniprot/P18892.fasta
Gene Name BTN1A1
Gene Id 282157
Protein Existence Status Reviewed: Experimental evidence at protein level

Secondry Information

Presence in other biological fluids/tissue/cells Abundant in milk fat globule membrane,
Protein Function butyrophilin mRNA correlates with the onset of milk fat secretion toward the end of pregnancy and is maintained throughout lactation; acts as a receptor, facilitating the interaction between cytoplasmic lipid droplets and the apical plasma membrane; the major component of a proteinaceous layer between the plasma membrane and lipid droplet surface; associated with complex immunological phenomena; regulate the function of T cells by engaging poorly defined receptors on both αβ and γδ T cells
Biochemical Properties Associates with membranes via a single hydrophobic domain that is in the approximate middle of the sequence; Soluble forms of butyrophilin may accumulate between the fat droplet and the apical plasma membrane and become incorporated into the coat by association with other MFGM proteins or by self-association with the membrane-bound form of butyrophilin in the apical plasma membrane; incorporated into the protein coat by a massive rearrangement of the apical surface as the lipid droplets approach the plasma membrane; has motifs, especially hydrophobic domains that may interact with the surface of fat droplets in the apical cytoplasm
Significance in milk protein associated in large amounts with MFGM and has function in the secretion of milk fat globules
PTMs N linked glycosylation in the exoplasmic domain; presence of mannaose, galactose and N-acetylglucosamine; 3 potential N-glycosylation sites - 2 in the -NH2 terminal and 1 in -COOH terminal; Acylation with myristate, stearate, palmitate and oleate
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P18892|BT1A1_BOVIN Butyrophilin subfamily 1 member A1 OS=Bos taurus OX=9913 GN=BTN1A1 PE=1 SV=2
MAVFPNSCLAGCLLIFILLQLPKLDSAPFDVIGPQEPILAVVGEDAELPC RLSPN*55VSAKGMELRWFREKVSPAVFVSREGQEQEGEEMAEYRGRVSLVED HIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHI SMKVQESGEIQLECTSVGWYPEPQVQWRTHRGEEFPSMSESRNPDEEGLF TVRASVIIRDSSMKN*215VSCCIRNLLLGQEKEVEVSIPASFFPRLTPWMVAV AVILVVLGLLTIGSIFFTWRLYKERSRQRRNEFSSKEKLLEELKWKRATL HAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKPERFDSWPCVMGR EAFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYG NGYWALTPLRTPLPLAGPPRRVGVFLDYESGDIFFYNMTDGSHIYTFSKA SFSGPLRPFFCLWSCGKKPLTICPVTDGLEGVMVVADAKDISKEIPLSPM GEDSASGDIETLHSKLIPLQPSQGVP
PDB ID 4hh8,
Bibliography 1. Franke, W. W., Heid, H. W., Grund, C., Winter, S., Freudenstein, C., Schmid, E., Jarasch, E. D., and Keenan, T. W. (1981) Antibodies to the major insoluble milk fat globule membrane-associated protein: specific location in apical regions of lactating epithelial cells. J. Cell Biol. 89, 485–494.
2. Franke, W. W., Lüder, M. R., Kartenbeck, J., Zerban, H., and Keenan, T. W. (1976) Involvement of vesicle coat material in casein secretion and surface regeneration. J. Cell Biol. 69, 173–195.
3. Gavel, Y. and von Heijne, G. (1990) Sequence differences between glycosylated and non-glycosylated Asn-X-Thr/Ser acceptor sites: implications for protein engineering. Protein Eng. 3, 433–442.
4. Hirano, H., Parkhouse, B., Nicolson, G. L., Lennox, E. S., and Singer, S. J. (1972) Distribution of saccharide residues on membrane fragments from a myeloma-cell homogenate: its implications for membrane biogenesis. Proc. Natl. Acad. Sci. U. S. A. 69, 2945–2949.
5. Keenan, T. W., Heid, H. W., Stadler, J., Jarasch, E. d, and Franke, W. W. (1982) Tight attachment of fatty acids to proteins associated with milk lipid globule membrane. Eur. J. Cell Biol. 26, 270–276.
6. Freudenstein, C., Keenan, T. W., Eigel, W. N., Sasaki, M., Stadler, J., and Franke, W. W. (1979) Preparation and characterization of the inner coat material associated with fat globule membranes from bovine and human milk. Exp. Cell Res. 118, 277–294