Search by BoMiProt ID - Bomi10793


Primary Information

BoMiProt ID Bomi10793
Protein Name Zinc finger Y-chromosomal protein
Organism Bos taurus
Uniprot IdQ95LI3
Milk FractionWhey
Ref Sequence Id NP_803457.1
Aminoacid Length 801
Molecular Weight 90344
Fasta Sequence https://www.uniprot.org/uniprot/Q95LI3.fasta
Gene Name ZFY
Gene Id 280962
Protein Existence Status reviewed

Secondary Information

Protein Function role in male sex determination.actively transcribed in males and appears to be involved in sperm or testis maturation
Biochemical Properties  In human,a protein with 13 zinc fingers.Binds to the consensus sequence 5'-AGGCCY-3'
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95LI3|ZFY_BOVIN Zinc finger Y-chromosomal protein OS=Bos taurus OX=9913 GN=ZFY PE=2 SV=1 MDEDEFELQPQEPNSCFDGIGTDATHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDP DSVVIQDVIENVVIEDVQCSDILEEADVSENVIIPEQMLSSDVTEEVSLAHCTVPDDVLA SDITSASMSMPEHVLTSESVHVSDVGHVEHIVHGSVVEAEIVTDPLTADVVSEEVLVADC ASEAVIDANGIPVDQQDDDKGNCEDYLMISLDDDGKMEHDCSSGMTMDAESEIDPCKVDG TCPEVIKVYIFKADPGEDDLGGTVDIVES*269EPENDHGVELLDQNNSIRMPREKMVYMTVND SQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAATTVHEQEMDDSEIKTFMPIAWAAAY GNNSDGIENRSGTASALLHIDESAGLGRLTKHKPKKRRRPDSRQYQTAIIIGPDGHPLTV YPCMICGKKFKSRGFLKRHMKNHPEHLTKKKYRCTDCDYTTNKKISLHNHLESHKLTSKS EKAIECDDCGKHFSHAGALFTHKMVHKEKGASKMHKCKFCEYETAEQGLLNRHLLAVHSK NFPHICVECGKGFRHPSELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMS FKCDICLLTFSDTKEVQQHALIHQESKTHQCVHCDHKSSNSSDLKRHIISVHTKDYPHKC DMCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRC KKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKG FRRPSEKNQHITRHHKEVGLP
Predicted Disorder Regions 1-24, 269-296
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Schneider-Gädicke A, Beer-Romero P, Brown LG, Mardon G, Luoh SW, Page DC. Putative transcription activator with alternative isoforms encoded by human ZFX gene. Nature. 1989 Dec 7;342(6250):708-11. doi: 10.1038/342708a0. PMID: 2512506.