Search by BoMiProt ID - Bomi10792


Primary Information

BoMiProt ID Bomi10792
Protein Name Zinc finger SWIM domain-containing protein 8
Organism Bos taurus
Uniprot IdA7E305
Milk FractionWhey,MFGM
Ref Sequence Id NP_001095619.1
Aminoacid Length 1413
Molecular Weight 152380
Fasta Sequence https://www.uniprot.org/uniprot/A7E305.fasta
Gene Name ZSWIM8
Gene Id 533041
Protein Existence Status reviewed

Secondary Information

Protein Function Enables ubiquitin ligase-substrate adaptor activity. Involved in positive regulation of miRNA catabolic process; proteasome-mediated ubiquitin-dependent protein catabolic process; and protein ubiquitination.
Biochemical Properties ZSWIM8 ubiquitin ligase recognizes conformational changes that occur upon extensive pairing to the miRNA 3-prime region, leading to polyubiquitination of AGO. Polyubiquitinated AGO is then degraded by the 26S proteasome, exposing the miRNA to cytoplasmic nucleases. contains a VHL box and SWIM domain and is thus recognized as a Cul2-type ubiquitin ligase. A SWIM domain is found in bacterial SWI2/SNF2 ATPases and MuDR transposases and is predicted to have DNA-binding and protein–protein interaction functions.
Significance in milk a myogenic protein
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7E305|ZSWM8_BOVIN Zinc finger SWIM domain-containing protein 8 OS=Bos taurus OX=9913 GN=ZSWIM8 PE=2 SV=1 MELMFAEWEDGERFSFEDSDRFEEDSLCSFISEAES*36LCQNWRGWRKQS*48AGPNS*53PTGGGGG GGSGGTRMRDGLVIPLVELSAKQVAFHIPFEVVEKVYPPVPEQLQLRIAFWSFPENEEDI RLYSCLANGSADEFQRGDQLFRMRAVKDPLQIGFHLSATVVPPQMVPPKGAYNVAVMFDR CRVTSCSCTCGAGAKWCTHVVALCLFRIHNASAVCLRAPVSESLSRLQRDQLQKFAQYLI SELPQQILPTAQRLLDELLSSQSTAINTVCGAPDPTAGPSASDQSTWYLDESTLTDNIKK TLHKFCGPSPVVFSDVNSMYLSSTEPPAAAEWACLLRPLRGREPEGVWNLLSIVREMFKR RDSNAAPLLEILTVELAQDLLANPPDLKVEPPPAKGKKNKVSTSRQTWVATNTLTKAAFL LTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVATLLKKIPLGPSEMS TVRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNNEMPGDEEL GFEAAVAALGMKTTVSEAEHPLLCEGTRREKGDLALALMITYKDDQARLKKILDKLLDRE SQTHKPQTLSSFYSSSRPATASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG PTEGFTEKNVPESSPHSPCEGLPPEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPK KKHT*724GMASIDSSAPETTS*738DSS*741PTLS*745RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN SSTSIFTHPSSS*852GGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQA MEIGSAALTILVECWDGHLTPPEVASLADRASRARDSNMVRAAAELALSCLPHAHALNPN EIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR EGATSCSASGIRAAGEAGRGLPEGRGGPGTEPVTVAAAAVTAATVVPVISVGSSLYPGPG LGHGHSPGLHPYTALQPHLPCSPQYLTHPAHPAHPMPHMPRPAVFPVASSAYPQGVHPAF LGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPASTFPAI QGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHN DHPNNFSRSPPYTDDVKWLLGLAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLS PAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAFCLTPMG MMQFNDILQNLKRSKQTKELWQRVSLEMTTFSP
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  Target-directed miRNA degradation (TDMD) required the ZSWIM8 Cullin-RING E3 ubiquitin ligase. 
Bibliography 1.Shi CY, Kingston ER, Kleaveland B, Lin DH, Stubna MW, Bartel DP. The ZSWIM8 ubiquitin ligase mediates target-directed microRNA degradation. Science. 2020 Dec 18;370(6523):eabc9359. doi: 10.1126/science.abc9359. Epub 2020 Nov 12. PMID: 33184237; PMCID: PMC8356967. 2.Okumura, F., Oki, N., Fujiki, Y. et al. ZSWIM8 is a myogenic protein that partly prevents C2C12 differentiation. Sci Rep 11, 20880 (2021). https://doi.org/10.1038/s41598-021-00306-6