Search by BoMiProt ID - Bomi10787


Primary Information

BoMiProt ID Bomi10787
Protein Name Zinc finger protein AEBP2/Adipocyte enhancer-binding protein 2/AE-binding protein 2
Organism Bos taurus
Uniprot IdA4FV57
Milk FractionWhey
Ref Sequence Id NP_001076954.2
Aminoacid Length 511
Molecular Weight 54049
Fasta Sequence https://www.uniprot.org/uniprot/A4FV57.fasta
Gene Name AEBP2
Gene Id 537791
Protein Existence Status reviewed

Secondary Information

Protein Function AEBP2 is a zinc finger protein that has been shown to interact with the mammalian Polycomb Repression Complex 2 (PRC2).Plays a role in nucleosome localization of the PRC2 complex.
Biochemical Properties These isoforms show developmental stage-specific expression patterns: the adult-specific larger form (51 kDa) and the embryo-specific smaller form (32 kDa).AEBP2 binds to a consensus sequence with bipartite structure, CTT(N)15-23cagGCC, and this binding is mainly driven by the three zinc finger units.the mammalian AEBP2 sequences can be divided into six protein domains: acidic, neutral, serine-rich, zinc finger, basic and lysine-rich domains. Among these six domains, two domains (zinc finger and basic).
PTMs Acetylation on Ala, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FV57|AEBP2_BOVIN Zinc finger protein AEBP2 OS=Bos taurus OX=9913 GN=AEBP2 PE=2 SV=2 MAAALTDMADLEELSRLS*18PLPPGS*24PGPAARGRAEPPEEEEEEDEEEEAEAEAVAALLLNG GGGGGGVGGGEAETMSEPSPESASQAGEDDDEEEDDDEEEEDESSSGGGEEESSAESLVG SSSGGSSSDETRSLS*135PGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGD EGYGTGGGGSSATSGGRRGS*200LEMS*204S*205DGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMM NGQGSTTSSSKNIAYNCCWDQCQACFTSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYN TPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPK AKEESPSKAGMNKRRKLKNKRRRS*384LPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGH SVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTAL LLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ
Predicted Disorder Regions 5-249, 348-351, 362-372
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Kim H, Kang K, Kim J. AEBP2 as a potential targeting protein for Polycomb Repression Complex PRC2. Nucleic Acids Res. 2009 May;37(9):2940-50. doi: 10.1093/nar/gkp149. Epub 2009 Mar 17. PMID: 19293275; PMCID: PMC2685092.