Search by BoMiProt ID - Bomi10774


Primary Information

BoMiProt ID Bomi10774
Protein Name Zinc finger protein 668
Organism Bos taurus
Uniprot IdQ2TA17
Milk FractionWhey
Ref Sequence Id NP_001070421.1
Aminoacid Length 619
Molecular Weight 68095
Fasta Sequence https://www.uniprot.org/uniprot/Q2TA17.fasta
Gene Name ZNF668
Gene Id 767831
Protein Existence Status reviewed

Secondary Information

Protein Function suppresses non-small cell lung cancer invasion and migration by downregulating Snail and upregulating E-cadherin and zonula occludens-1
Biochemical Properties ZNF668 has been demonstrated to mediate Tip60 acetylation and ionizing radiation-induced hyperacetylation of H2A histone family member X following DNA damage
Significance in milk ZNF668 has been demonstrated to mediate Tip60 acetylation and ionizing radiation-induced hyperacetylation of H2A histone family member X following DNA damage
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus OX=9913 GN=ZNF668 PE=2 SV=2 MEVESPEERS*10PAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGLADCTEEMAEAKLKP ETDPKAEDASGDKVSGAAAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRR FMQPVCLRVHLASHAGELPFRCAHCPKAYGALSKLKIHQRGHTGERPYTCADCGKSFADP SVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHTGERPFLCSECGKSFSRSSSLT CHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPFLCPRCGRMFSDPSSFRRHQR AHEGVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHALVHSG QRPFRCEECGRAFAERASLTKHSRVHSGERPFHCNACGKSFVVSSSLRKHERTHRSSEAT GAPPQQELVVGLALPVSMAGEGPAAPASGAALGDPPAGLLGLPSESGGVMATQWQVVGMT VEHVECQDAGVGEAPGPLGAAGEVGGEEVDEKPPQFVCRECKETFSTLTLLRRHERSHPE LRPFHCTQCGKSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPIGT PTPLEPLVALLGMPEEGPA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Hu R, Wang E, Peng G, Dai H and Lin SY: Zinc finger protein 668 interacts with Tip60 to promote H2AX acetylation after DNA damage. Cell Cycle. 12:2033–41. 2013. View Article : Google Scholar : PubMed/NCBI 2.Zhang X, Jiang G, Wu J, Zhou H, Zhang Y, Miao Y, Feng Y, Yu J. Zinc finger protein 668 suppresses non-small cell lung cancer invasion and migration by downregulating Snail and upregulating E-cadherin and zonula occludens-1. Oncol Lett. 2018 Mar;15(3):3806-3813. doi: 10.3892/ol.2018.7802. Epub 2018 Jan 16. PMID: 29556277; PMCID: PMC5844101.