Search by BoMiProt ID - Bomi10760


Primary Information

BoMiProt ID Bomi10760
Protein Name Zinc finger protein 574
Organism Bos taurus
Uniprot IdQ29RK0
Milk FractionWhey
Ref Sequence Id NP_001070007.1
Aminoacid Length 896
Molecular Weight 99010
Fasta Sequence https://www.uniprot.org/uniprot/Q29RK0.fasta
Gene Name ZNF574
Gene Id 767618
Protein Existence Status reviewed

Secondary Information

Protein Function transcripitional regulation
Biochemical Properties Contain zinc finger domain C2H2-type(C2H2-type 1 to type 20)
PTMs Phosphorylation and Methylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus OX=9913 GN=ZNF574 PE=2 SV=1 MTEESEETVLYIEHRYVCSECNQLYGSLEEVLMHQNSHVPQQHFELVGVADPGVTVAAEA ASGTGLYQTLVQESQYQCLECGQLLMSPSQLLEHQELHLKMMAPQEAVPAEPPPKAPALS SSTIHYECVDCKALFASQELWLNHRQTHLRATPTKPPTPVVLGS*164PVVVGSPVGQTRVAVE HSYRKAEEGGEGAAVPSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQATHFPAP APESEEPVLQQETLTPAPVEVPVSQPEPVPSSDHSYELRNGEALGRDRRGRRARRNNS*298GE PGGAATQELFCSACDQLFLSPHQLQQHLRSHREGVFKCPLCSRVFPSPSSLDQHLGDHSS ESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGVGGVPL PTTPVPPEEPVLGFPEPAPAETGEPEAPEPPVAEESSAEPAAPGTYRCLLCSREFGKALQ LTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLAR HRLTHTGERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYH HTGEYPYKCRECPRSFLLRRLLEVHQLVAHAGRQPHRCSSCGAAFPSSLRLREHRCAAAA AQAPRRFECGTCGKKVGSAARLQAHEAAHAAAGPGEVLAKEPPAPRAPRAARTPITS*717PTT LGSAAPAAPAAPARRRGLECSECKKLFSTETSLQVHRRIHTGERPYPCPDCGKAFRQSTH LKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKH RKTHQQQHQAAVRQQLAEAEAAVGLAVMETAVEALPLVEAIEIYPLAEAEGVQISG
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices