Search by BoMiProt ID - Bomi10742


Primary Information

BoMiProt ID Bomi10742
Protein Name Zinc finger protein 397
Organism Bos taurus
Uniprot IdQ1LZ87
Milk FractionWhey
Ref Sequence Id NP_001068730.1
Aminoacid Length 534
Molecular Weight 61277
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZ87.fasta
Gene Name ZNF397
Gene Id 506448
Protein Existence Status reviewed

Secondary Information

Protein Function ZNF397 is a transcription factor that plays a role in the regulation of transcription at the centromere.
Biochemical Properties belongs to the classical Cys(2)His(2) group of the zinc-finger protein superfamily and contains two conserved domains: a leucine-rich SCAN domain and nine Cys(2)His(2) zinc fingers.The SCAN plus linker domain is required for centromere localisation.The SCAN domain is a highly conserved 84-residue motif found near the N-terminus of a subfamily of C2H2 zinc-finger proteins that mediates protein–protein interaction.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus OX=9913 GN=ZNF397 PE=2 SV=1 MAVESRAVSTPVPQNSQEQELILVKVEESRS*31WGQKLKQSGSARSCQELFRQQFRKFCYQE TPGPREALGRLQELCYQWLRPELHTKEQILELLVLEQFLSILPEELQIWVQQHSPKNGEE AVTLLEDLEREFDDPGQQVPATPQGPPMPWKDLTCLGAAQEFTHIQRQPLKKQLKPWEPC LPPKSGCENNESAIKKDISGEKSQRLSQEPSFGGFSEHKSSLEWQQGSAPGETLRRSPSQ RASFSPVIFTHKLLANRDHPEPQRNLILSTNSVTYQKVPTEERPYRCDICGHSFKQHSSL TQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHR KIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT GERPYECNECGKAFRQSSELITHQRIHSGEKPYECNECGKAFSLSSNLIRHQRIHSGEEP YQCNECGKTFKRSSALVQHQRIHSGEEAYICSECGKAFRHRSVLTRHQRVHTVK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Zfp397 null mice appear phenotypically normal. The nulls are fertile and generate normal litter size and Mendelian ratios of offspring
Bibliography Bailey SL, Chang SC, Griffiths B, Graham AN, Saffery R, Earle E, Choo KH, Kalitsis P. ZNF397, a new class of interphase to early prophase-specific, SCAN-zinc-finger, mammalian centromere protein. Chromosoma. 2008 Aug;117(4):367-80. doi: 10.1007/s00412-008-0155-7. Epub 2008 Mar 28. PMID: 18369653.