Search by BoMiProt ID - Bomi10712


Primary Information

BoMiProt ID Bomi10712
Protein Name Zinc finger protein 143/Selenocysteine tRNA gene transcription-activating factor
Organism Bos taurus
Uniprot IdA6QQW0
Milk FractionWhey
Ref Sequence Id NP_001095624.1
Aminoacid Length 613
Molecular Weight 66079
Fasta Sequence https://www.uniprot.org/uniprot/A6QQW0.fasta
Gene Name ZNF143/STAF
Gene Id 533243
Protein Existence Status reviewed

Secondary Information

Protein Function Zinc-finger protein 143 (ZNF143) on cancer cell motility in colon cancer cells.ZNF143 selectively expresses in duct and gland epithelium of normal breast tissues, which decreases when the tissue become malignant.
Biochemical Properties ZNF143 is involved in cellular motility through a ZEB1-E-cadherin-linked pathway in colon cancer cells.
PTMs Acetylation at Meth,Phosphorylation Thr,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus OX=9913 GN=ZNF143 PE=2 SV=1 MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGST AYIQHNSKDGSAAYVQHVPIPKTTGDSLRLEDGQAVQLEDSYDQSALQAVQLEDGTTAYI HHAVQVPQSDTILAIQADGTVAGLHTGDAAIDPDTISALEQYAAKVSIDGSEGVTGSGII GENEQEKKMQIVLQGHATRVTAKSQQSGEKAFRCGYDGCGKLYTTAHHLKVHERSHTGDR PYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGER PFKCHFEGCGRSFTTSNIRKVHIRTHT*327GERPYYCTEPGCGRAFASATNYKNHVRIHTGEK PYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLAMHKRTAHNDTEP IEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDG TQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGAHSVAMVTAEGTEGQQVAI VAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIA SRIQQGETPGLDD
Predicted Disorder Regions 11-14, 465-489, 594-613
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Loss of ZNF143 may contribute to the development of colon cancer by regulating intracellular and intercellular signalling for cell plasticity and the tumour microenvironment respectively.
Bibliography 1.Paek AR, Mun JY, Hong KM, Lee J, Hong DW, You HJ. Zinc finger protein 143 expression is closely related to tumor malignancy via regulating cell motility in breast cancer. BMB Rep. 2017 Dec;50(12):621-627. doi: 10.5483/bmbrep.2017.50.12.177. PMID: 29065970; PMCID: PMC5749908. 2.Paek AR, Lee CH, You HJ. A role of zinc-finger protein 143 for cancer cell migration and invasion through ZEB1 and E-cadherin in colon cancer cells. Mol Carcinog. 2014 Feb;53 Suppl 1:E161-8. doi: 10.1002/mc.22083. Epub 2013 Sep 5. PMID: 24009065. 3.Verma V, Paek AR, Choi BK, Hong EK, You HJ. Loss of zinc-finger protein 143 contributes to tumour progression by interleukin-8-CXCR axis in colon cancer. J Cell Mol Med. 2019 Jun;23(6):4043-4053. doi: 10.1111/jcmm.14290. Epub 2019 Apr 1. PMID: 30933430; PMCID: PMC6533486.