Search by BoMiProt ID - Bomi10692


Primary Information

BoMiProt ID Bomi10692
Protein Name Zinc finger CCHC-type and RNA-binding motif-containing protein 1/U11/U12 small nuclear ribonucleoprotein 31 kDa protein/U11/U12 snRNP 31 kDa protein
Organism Bos taurus
Uniprot IdQ56JZ7
Milk FractionWhey
Ref Sequence Id NP_001020489.1
Aminoacid Length 217
Molecular Weight 24620
Fasta Sequence https://www.uniprot.org/uniprot/Q56JZ7.fasta
Gene Name ZCRB1
Gene Id 504536
Protein Existence Status reviewed

Secondary Information

Protein Function a nuclear protein remain outside the nucleolus,binds to RNA acts as transcription factor or repressor.Likely to be involved in morphine dependence, cold/heat stress, and hepatocarcinoma.
Biochemical Properties The 5'-flanking region contains an enhancer core motif and binding sites for AP-1, AP-2, and LF-A1. ZCRB1 is characterized by an RNA-binding motif and a CCHC zinc finger motif. The latter overlaps the C..C...GH....C core nucleocapsid motif. ZCRB1 is conserved from zebrafish to human and shares homology with cold-inducible RNA-binding protein.Human ZCRB1 has significant homology with human SFRS7 RNA-splicing factor 9G8 (33%/116 aa), sex-lethal protein SXL2(39%/71 aa) of Lucilia cuprina, blowfly , and mouse cold-inducible RNA-binding protein (29%/110 aa).
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus OX=9913 GN=ZCRB1 PE=2 SV=1 MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRRSKGVAFILFLD KDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYAC PKNMLGEREPPKKKEKKKKKKIPEPEEEIEEVEES*155EDEGEDPALDSLSQAIAFQQAKIEE EQKKWKPSSGGPSTSDDSRRPRIKKSTYFS*210DEEELS*216D
Predicted Disorder Regions 1-5, 43-47, 117-217
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments ZCRB1 gene expression was found to be stimulated by morphine, inhibited by 30-36 degrees C, and up-regulated by 39 degrees C incubation in SH-SY5Y neural cells. Zcrb1 gene expression is highest in the heart and testes, lower in the cerebellum, and lowest in the liver in mice.
Bibliography 1.Wang H, Gao MX, Li L, Wang B, Hori N, Sato K. Isolation, expression, and characterization of the human ZCRB1 gene mapped to 12q12. Genomics. 2007 Jan;89(1):59-69. doi: 10.1016/j.ygeno.2006.07.009. Epub 2006 Sep 7. PMID: 16959469.