Search by BoMiProt ID - Bomi10686


Primary Information

BoMiProt ID Bomi10686
Protein Name Zinc finger CCCH domain-containing protein 14
Organism Bos taurus
Uniprot IdQ3ZC82
Milk FractionWhey
Ref Sequence Id NP_001029578.1
Aminoacid Length 735
Molecular Weight 82023
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZC82.fasta
Gene Name ZC3H14
Gene Id 511473
Protein Existence Status reviewed

Secondary Information

PTMs Acetylation, Phosphorylation,Ubl conjugation,isopeptide bond formation
Linking IDs Bomi10686
PTMs Acetylation, Phosphorylation,Ubl conjugation,isopeptide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus OX=9913 GN=ZC3H14 PE=2 SV=2 MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTI RFTVWLHGVLDKLRSVTTDPAS*85LKSSDTNLFDGNVPSNKSSFSRGDERRHEAAVPPLAVS STRPEKRESRVSTSSQEQKATNVRQTYDDGAATRLMSTVKPLRELAPSEDVIDIKPEPDD LIDEDLNFVQENPLSQKKTTVTLTYGSSRPSIEIYRPPATRNTDSGAHLNRLQFQQQQNS*240 IHAAKQLDIQSSRVYETGRLCEPEVLNSLEETYSPFFRSNAEKMSIEEENFRKRKLPVVS SVVKVKKFS*309HDGEEEEEDDDCGSRTGS*327ISSSVSVPAKPERRPS*343LPPSKQANKNLILKAIS EAQESVTKTTNYSTVSQKQTLPVAPRTRTS*390QEDLLAEVAQGHGRVPRIS*409SPVKEEEAQGG S*421VDERQGTQQRQLLSRLQIDPVMAETLQISQDYYDMESMVHADTRSFILKKPKLCEELVV AASQASGMETADALQARS*498GHLVQTRDLVQPDKPAS*515PKFIVTLDGVPS*527PPGYMSDQEEDMC SEGMRPAQHPAASHGGLAGLLHPQRSRVLSRQLEDPDGSFANAEMSELSVAQKPEKLLER CKYWPACKNGDECAYHHPVS*620PCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHMSRR TPGLPPKPVTAPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCAFYHPTITV PPRHALKWIRPQTSD
Predicted Disorder Regions 9 disordered segments; (78-154), (176-191), (224-255), (295-305), (329-349), (372-443), (506-513), (553-563), (664-670)
DisProt Annotation
TM Helix Prediction No TM helices
Linking IDs