Search by BoMiProt ID - Bomi10685


Primary Information

BoMiProt ID Bomi10685
Protein Name Zinc finger and BTB domain-containing protein 18/Zinc finger protein 238
Organism Bos taurus
Uniprot IdA0JN76
Milk FractionWhey
Aminoacid Length 522
Molecular Weight 58356
Fasta Sequence https://www.uniprot.org/uniprot/A0JN76.fasta
Gene Name ZBTB18/ZNF238
Gene Id 538793
Protein Existence Status reviewed

Secondary Information

Protein Function A nuclear DNA marker, ZNF238, can be used to increase the accuracy of species identification among euteleostomi (bony vertebrates).
Biochemical Properties The nuclear gene ZNF238 is a common gene among euteleostomi and encodes zinc finger protein 238, which acts as a transcriptional activator or repressor and is involved in chromatin assembly
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus OX=9913 GN=ZBTB18 PE=2 SV=2 MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKR DIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEK ATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPS*157DEDEGEDEKLNILPSKRDLAAEP GNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVL DLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKES VSTNNRVQYEPAHLAPLREDSVLRELEREDKASDDEMMTPESERVQVEGGMESSLLPYVS NILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGLRSKPAADVNVPTCSLCGKTFS CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGD LYRHIRKFHCELVNSLSVKSEALSLPAVRDWTLEDS*516S*517QELWK
Predicted Disorder Regions 117-226, 245-288, 307-323, 334-342
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  zinc finger protein 238 (ZNF238), known as a tumor suppressor, was regulated by miR-20b over-expres-sion.
Bibliography 1.Kim W, Kim S, Choi H, Truong ND, Thong le M, Kim JH, Xiao R, Park KK, Seo K, Lee H, Kim BS, Yoo MH, Park C. Discrimination of animal species using polymorphisms of the nuclear gene zinc finger protein 238. J Agric Food Chem. 2010 Feb 24;58(4):2398-402. doi: 10.1021/jf9036968. PMID: 20085280. 2.Lu L, Chen XM, Tao HM, Xiong W, Jie SH, Li HY. Regulation of the expression of zinc finger protein genes by microRNAs enriched within acute lymphoblastic leukemia-derived microvesicles. Genet Mol Res. 2015 Oct 5;14(4):11884-95. doi: 10.4238/2015.October.5.2. PMID: 26505336. 3.Aoki, K.; Meng, G.; Suzuki, K. RP58 associates with condensed chromatin and mediates a sequence-specific transcriptional repression. J. Biol. Chem. 1998, 273, 26698–26704.