Primary Information |
---|
BoMiProt ID | Bomi10661 |
---|
Protein Name | Zeta-crystallin |
---|
Organism | Bos taurus |
---|
Uniprot Id | O97764 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_776450.2 |
---|
Aminoacid Length | 330 |
---|
Molecular Weight | 35383 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/O97764.fasta |
---|
Gene Name | CRYZ |
---|
Gene Id | 281093 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | CryZ plays a key role also in apoptosis by the regulation of antiapoptotic factors such as Bcl-2 |
---|
Biochemical Properties | CryZ, was shown to be a single-stranded (ss)- DNA-binding protein whose bond can be reversed by its enzyme cofactor NADPH |
---|
Significance in milk | lens formation |
---|
PTMs | Acetylation and Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
MATGQKLMRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHN
IKPLLPYTPGFDVAGIIEAVGESVSAFKKGDRVFTTRTISGGYAEYALAADHTVYTLPEK
LDFKQGAAIGIPYFTAYRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTA
STEEGQKIVLENGAHKVFNHKEADYIDKIKKSVGEKGVDVIIEMLANVNLSNDLNLLSHG
GRVIVVGS*248RGTIEINPRDTMTKESSIKGVTLFSSTKEEFQQFAAALQAGMEIGWLRPVIG
PQYLLEKATQAHENIIHSSGATGKMILLLN
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | The enhanced binding of CryZ to its mRNA targets, including the GLS and GDH mRNAs, may be mediated by its phosphorylation status |
---|
Additional Comments | novel lens protein from the guinea pig |
---|
Bibliography | 1.Lapucci A, Lulli M, Amedei A, Papucci L, Witort E, Di Gesualdo F, Bertolini F, Brewer G, Nicolin A, Bevilacqua A, Schiavone N, Morello D, Donnini M, Capaccioli S. zeta-Crystallin is a bcl-2 mRNA binding protein involved in bcl-2 overexpression in T-cell acute lymphocytic leukemia. FASEB J. 2010 Jun;24(6):1852-65. doi: 10.1096/fj.09-140459. Epub 2010 Jan 26. PMID: 20103721; PMCID: PMC2874474. 2.Kranthi BV, Balasubramanian N, Rangarajan PN (2006) Isolation of a single-stranded DNA-binding protein from the methylotrophic yeast, Pichia pastoris and its identifcation as zeta crystallin. Nucl Acids Res 34(14):4060–4068 |