Search by BoMiProt ID - Bomi10661


Primary Information

BoMiProt ID Bomi10661
Protein Name Zeta-crystallin
Organism Bos taurus
Uniprot IdO97764
Milk FractionWhey
Ref Sequence Id NP_776450.2
Aminoacid Length 330
Molecular Weight 35383
Fasta Sequence https://www.uniprot.org/uniprot/O97764.fasta
Gene Name CRYZ
Gene Id 281093
Protein Existence Status reviewed

Secondary Information

Protein Function CryZ plays a key role also in apoptosis by the regulation of antiapoptotic factors such as Bcl-2
Biochemical Properties CryZ, was shown to be a single-stranded (ss)- DNA-binding protein whose bond can be reversed by its enzyme cofactor NADPH
Significance in milk lens formation
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2 MATGQKLMRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHN IKPLLPYTPGFDVAGIIEAVGESVSAFKKGDRVFTTRTISGGYAEYALAADHTVYTLPEK LDFKQGAAIGIPYFTAYRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTA STEEGQKIVLENGAHKVFNHKEADYIDKIKKSVGEKGVDVIIEMLANVNLSNDLNLLSHG GRVIVVGS*248RGTIEINPRDTMTKESSIKGVTLFSSTKEEFQQFAAALQAGMEIGWLRPVIG PQYLLEKATQAHENIIHSSGATGKMILLLN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The enhanced binding of CryZ to its mRNA targets, including the GLS and GDH mRNAs, may be mediated by its phosphorylation status
Additional Comments novel lens protein from the guinea pig
Bibliography 1.Lapucci A, Lulli M, Amedei A, Papucci L, Witort E, Di Gesualdo F, Bertolini F, Brewer G, Nicolin A, Bevilacqua A, Schiavone N, Morello D, Donnini M, Capaccioli S. zeta-Crystallin is a bcl-2 mRNA binding protein involved in bcl-2 overexpression in T-cell acute lymphocytic leukemia. FASEB J. 2010 Jun;24(6):1852-65. doi: 10.1096/fj.09-140459. Epub 2010 Jan 26. PMID: 20103721; PMCID: PMC2874474. 2.Kranthi BV, Balasubramanian N, Rangarajan PN (2006) Isolation of a single-stranded DNA-binding protein from the methylotrophic yeast, Pichia pastoris and its identifcation as zeta crystallin. Nucl Acids Res 34(14):4060–4068