Search by BoMiProt ID - Bomi10649


Primary Information

BoMiProt ID Bomi10649
Protein Name YTH domain-containing family protein 2
Organism Bos taurus
Uniprot IdQ0VCZ3
Milk Fractionwhey
Ref Sequence Id NP_001069721.1
Aminoacid Length 580
Molecular Weight 62449
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCZ3.fasta
Gene Name YTHDF2
Protein Existence Status Reviewed

Secondary Information

Protein Function role in cell proliferation, invasion, and cholesterol regulation ,regulation of neurogenesis
PTMs phosphorylation on Ser,Acetylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCZ3|YTHD2_BOVIN YTH domain-containing family protein 2 OS=Bos taurus OX=9913 GN=YTHDF2 PE=2 SV=1 MS*2AS*4S*5LLEQRPKGQGNKVQNGS*22VHQKDGLNDDDFEPYLS*39PQARPNNAYTAMSDSYLPSYY SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFASETLNKAP GMNTIDQGMAALKLGS*196TEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQQP TQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGS*360 GFGHNGVDGNGVGQTQAGSGSTPSEPHPVLEKLRS*395INNYNPKDFDWNLKHGRVFIIKSYS EDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDY NTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQ VLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  EGFR/SRC/ERK signaling phosphorylates YTHDF2 serine39 and threonine381, stabilizing YTHDF2 protein.