Search by BoMiProt ID - Bomi10631


Primary Information

BoMiProt ID Bomi10631
Protein Name X-box-binding protein 1
Organism Bos taurus
Uniprot IdQ3SZZ2
Milk FractionWhey
Ref Sequence Id NP_001029899.1
Aminoacid Length 261
Molecular Weight 28424
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZZ2.fasta
Gene Name XBP1
Gene Id 541236
Protein Existence Status reviewed

Secondary Information

Protein Function TF Required for cardiac myogenesis and hepatogenesis during embryonic development.regulates the transcription of genes involved in ER homeostasis.
Biochemical Properties XBP-1 as a member of the basic region leucine zipper protein family
Significance in milk regulates the biosynthetic capacity of mammary gland during lactation by controlling epithelial expansion and ER formation.
PTMs Phosphorylation on Ser and ubiquitination
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZZ2|XBP1_BOVIN X-box-binding protein 1 OS=Bos taurus OX=9913 GN=XBP1 PE=2 SV=1 MVVVAPAQSPAAGAPKVLLLSGQPAATGGAPAGRALPVMVPGQQGAS*47PEGASGVPPQARK RQRLTHLS*68PEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR EKTHGLVVENQELRQRLGMDALVTEEEAETKGNGAGLVAGSAESAALRLRAPLQQVQAQL SPLQNISPWTLMALTLQTLSLTSCWAFCSTWTQSCSSDVLPQSLPAWSSSQKWTQKDPVP YRPPLLHPWGRHQPSWKPLMN
Predicted Disorder Regions 4 disordered segments; (1-17), (22-89), (144-165), (228-261)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments When ER stress occurs, the IRE1α kinase is activated through autophosphorylation and acts as a stress sensor and transducer. IRE1α endoribonuclease activity then removes a 26 nucleotides intron from XBP-1u mRNA coding sequence inducing a frame shift. Thereafter, subsequent processed mRNA is translated onto a more stable 376 amino acids-long isoform XBP-1s (spliced), which bears the transcriptional activity.
Bibliography Dunys J, Duplan E, Checler F. The transcription factor X-box binding protein-1 in neurodegenerative diseases. Mol Neurodegener. 2014 Sep 12;9:35. doi: 10.1186/1750-1326-9-35. PMID: 25216759; PMCID: PMC4166022.