Search by BoMiProt ID - Bomi10611


Primary Information

BoMiProt ID Bomi10611
Protein Name Wiskott-Aldrich syndrome protein family member 1/WASP family protein member 1/Protein WAVE-1
Organism Bos taurus
Uniprot IdQ0IIJ3
Milk Fractionwhey
Ref Sequence Id NP_001029189.2
Aminoacid Length 559
Molecular Weight 61640
Fasta Sequence https://www.uniprot.org/uniprot/Q0IIJ3.fasta
Gene Name WASF1
Gene Id 531488
Protein Existence Status Reviewed

Secondary Information

Protein Function Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex
PTMs Phosphorylation and Methylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0IIJ3|WASF1_BOVIN Wiskott-Aldrich syndrome protein family member 1 OS=Bos taurus OX=9913 GN=WASF1 PE=2 SV=1 MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPT TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV QGLPPPPPPPPLPPPGIRPSSPVTVAALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVTP ASEPKRHPS*489TLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA VEYSDSEDDSEFDEVDWLE
Predicted Disorder Regions 170-204, 216-231, 247-249, 261-265, 310-349, 367-369, 474-486,543-559
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Eden, S., Rohatgi, R., Podtelejnikov, A. V., Mann, M., & Kirschner, M. W. (2002). Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck. Nature, 418(6899), 790–793. https://doi.org/10.1038/nature00859