Search by BoMiProt ID - Bomi10598


Primary Information

BoMiProt ID Bomi10598
Protein Name WD repeat-containing protein 44/Rab11-binding protein/Rabphilin-11
Organism Bos taurus
Uniprot IdQ9XSC3
Milk FractionWhey
Aminoacid Length 912
Molecular Weight 101293
Fasta Sequence https://www.uniprot.org/uniprot/Q9XSC3.fasta
Gene Name WDR44/RAB11BP
Gene Id 286825
Protein Existence Status reviewed

Secondary Information

Protein Function Rab11a small G protein (Rab11p) is implicated in vesicle trafficking, especially vesicle recycling. 
Biochemical Properties The Rab family small G proteins have two interconvertible forms, the GDP-bound inactive and GTP-bound active forms. The conversion of the GDP-bound form to the GTP-bound form is regulated by two types of upstream regulators, GEPs and GDIs. The reverse conversion is regulated by GTPaseactivating proteins. Each Rab family member appears to have its specific GEP and GTPase-activating protein, whereas GDIs are active on all the Rab family members.
PTMs Acetylation at Lys,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9XSC3|WDR44_BOVIN WD repeat-containing protein 44 OS=Bos taurus OX=9913 GN=WDR44 PE=1 SV=1 MAS*3ESDTEEFFDAPEDVHLEGGDPIGYPGKVGISALKETENSAYKVGNES*50TVQELKQDVS KKIIES*66IIEES*71QKVIQLEDDS*81LDSKGKGQSDQATAS*96PVTAGTELSNIPGLLAIDQVLQED SQKAES*126QDVSEETELESKQCFPSDDTCEKPVDETTKLT*158EISSTAQLNVPETVTEVLNKEE VEVKESDVLESASSHSLSTKDFAVVEEVAPAKPPRQLT*218PEPDIVASTKKPVPARPPPPAN FPPPRPPPPSRPAPPPRKKKS*261ELEFEALKT*270PDLDVPKENITSDTLLTTNMASESTVKDSQ PSLDLASATSGDKIVTAQENGKAPDGQTIAGEVMGPQRPRS*341NS*343GRELT*348DEEILASVMIKN LDTGEEIPLSLAEEKLPTGINPLTLHIMRRTKEYVSNDAAQS*402DDEEKLQSQQTDTDGGRL KQKTTQLKKFLGKSVKRAKHLAEEYGERAVNKVKSVRDEVFHTDQDDPS*469S*470S*471DDEGMPY*478TRPVKFKAAHGFKGPYDFDQIKVVQDLSGEHMGAVWTMKFSHCGRLLASAGQDNVVRIWALK NAFDYFNNMRMKYNTEGRVS*560PSPS*564QESLNSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFC KYKGHTADLLDLSWSKNYFLLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDR YFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDT EHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYK GYVNSSSQIKASFSHDFNYLVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHNA VVTSAIFAPNPSLMLSLDVQSEKSEGNEKGEDAEVLETMPSGIMKTDNTEVLLSADFTGA IKVFINKRKNLS
Predicted Disorder Regions 1-26, 44-46, 64-206, 249-253, 293-344
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Overexpression of the C-terminal fragment of rabphilin-11 (aa 607-730), lacking the GTP-Rab11 binding domain, in HeLa cells reduced accumulation of transferrin at perinuclear regions and cell migration.
Bibliography 1.Mammoto A, Ohtsuka T, Hotta I, Sasaki T, Takai Y. Rab11BP/Rabphilin-11, a downstream target of rab11 small G protein implicated in vesicle recycling. J Biol Chem. 1999 Sep 3;274(36):25517-24. doi: 10.1074/jbc.274.36.25517. PMID: 10464283. 2.Mammoto A, Sasaki T, Kim Y, Takai Y. Physical and functional interaction of rabphilin-11 with mammalian Sec13 protein. Implication in vesicle trafficking. J Biol Chem. 2000 May 5;275(18):13167-70. doi: 10.1074/jbc.c000096200. PMID: 10747849. 3.. Takai, Y., Sasaki, T., Shirataki, H., and Nakanishi, H. (1996) Genes Cells 1,615–632. 4. Novick, P., and Zerial, M. (1997) Curr. Opin. Cell Biol. 9, 496–504.