Search by BoMiProt ID - Bomi10596


Primary Information

BoMiProt ID Bomi10596
Protein Name WD repeat-containing protein 1
Organism Bos taurus
Uniprot IdQ2KJH4
Milk FractionWhey
Ref Sequence Id NP_001039811.1
Aminoacid Length 606
Molecular Weight 66258
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJH4.fasta
Gene Name WDR1
Gene Id 533223
Protein Existence Status reviewed

Secondary Information

Protein Function WD repeat-containing protein 1 maintains β-Catenin activity to promote pancreatic cancer aggressiveness.
Biochemical Properties WDR1 (WD-repeat domain 1) is a major cofactor of the actin depolymerizing factor (ADF)/cofilin, strongly accelerating ADF/cofilin-mediated actin disassembly. 
PTMs Acetylation at Lys and Phosphorylation at Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJH4|WDR1_BOVIN WD repeat-containing protein 1 OS=Bos taurus OX=9913 GN=WDR1 PE=2 SV=3 MPYEIKKVFASLPQVERGVSKIVGGDPKGNSFLYTNGKCVILRNIDNPAIADIYTEHAHQ VVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVV GEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLVTGSDDNCAAFFEGPPFK FKFTISDHGRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGGSKAHDGGIY*238AI SWSPDSTHLLSASGDKTSKIWDVNVNSVVNTFTMGSNVLDQQLGCLWQKDHLLSISLSGY INYLDKNNPSKPLRVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFA GKGHTNQVSRMTVDEHGQLVSCSMDDTVRYTNLTLRDYSGQGVVKLDVQPKCLAVGPGGY TVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGETVAVGGADGNVRLYSILGTTLK DEGKLLEAKGPVTDLAFSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAW SPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVK EWTIAY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated during mitosis,may leads to proper regulation of cell division.
Additional Comments WDR1 Promotes Cell Growth and Migration and Contributes to Malignant Phenotypes of Non-small Cell Lung Cancer through ADF/cofilin-mediated Actin Dynamics
Bibliography 1.Yuan B, Zhang R, Hu J, Liu Z, Yang C, Zhang T, Zhang C. WDR1 Promotes Cell Growth and Migration and Contributes to Malignant Phenotypes of Non-small Cell Lung Cancer through ADF/cofilin-mediated Actin Dynamics. Int J Biol Sci. 2018 Jun 8;14(9):1067-1080. doi: 10.7150/ijbs.23845. PMID: 29989053; PMCID: PMC6036740. 2.Li H, Liu X, Jiang S, Zhou X, Yao L, Di Y, Jiang Y, Gu J, Mao Y, Li J, Jin C, Yang P, Fu D. WD repeat-containing protein 1 maintains β-Catenin activity to promote pancreatic cancer aggressiveness. Br J Cancer. 2020 Sep;123(6):1012-1023. doi: 10.1038/s41416-020-0929-0. Epub 2020 Jun 30. PMID: 32601462; PMCID: PMC7492282.