Search by BoMiProt ID - Bomi10572


Primary Information

BoMiProt ID Bomi10572
Protein Name WD repeat and FYVE domain-containing protein 1/WD40- and FYVE domain-containing protein 1
Organism Bos taurus
Uniprot IdQ2KIY3
Milk FractionExosomes
Ref Sequence Id NP_001040007.1
Aminoacid Length 410
Molecular Weight 46281
Fasta Sequence https://www.uniprot.org/uniprot/Q2KIY3.fasta
Gene Name WDFY1
Gene Id 614729
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells testis
Protein Function Wdfy1 is reported to be a critical adapter molecule of the TLR 3/4 signaling pathway.
PTMs Phosphorylation at Serine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KIY3|WDFY1_BOVIN WD repeat and FYVE domain-containing protein 1 OS=Bos taurus OX=9913 GN=WDFY1 PE=2 SV=1 MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYW PSIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVTAI IFSLATEWVISTGHDKCVSWMCTRSGNMLGRHFFSSWASCLQYDFDTQYAFVGDYSGQIT LLKLEQSTCSVITTLKGHEGSIACLWWDPIQRLLFSGASDNSVIMWDIGGRKGRTLLLQG HHDRVQALCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQ MWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDSIKDEDRTSLA TFHEGKHNISHMSMDVARGLMVTCGTDRVVKIWDMTPVVGCSLATGFS*408PH
Predicted Disorder Regions 406-409
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments WDFY1 deficiency is related to impaired TLR3/TLR4 immune responses.
Bibliography 1.Hu Y.H., Zhang Y., Jiang L.Q., Wang S., Lei C.Q., Sun M.S., Shu H.B., Liu Y. WDFY1 mediates TLR3/4 signaling by recruiting TRIF. EMBO Rep. 2015;16:447–455. doi: 10.15252/embr.201439637. 2.Yang Y., Hu Y.H., Liu Y. Wdfy1 deficiency impairs Tlr3-mediated immune responses in vivo. Cell. Mol. Immunol. 2020;17:1014–1016. doi: 10.1038/s41423-020-0461-4. 3.Yeo I.J., Park M.H., Son D.J., Kim J.Y., Nam K.T., Hyun B.K., Kim S.Y., Jung M.H., Song M.J., Chun H.O., et al. PRDX6 Inhibits Neurogenesis through Downregulation of WDFY1-Mediated TLR4 Signal. Mol. Neurobiol. 2019;56:3132–3144. doi: 10.1007/s12035-018-1287-2.