Search by BoMiProt ID - Bomi10563


Primary Information

BoMiProt ID Bomi10563
Protein Name WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2
Organism Bos taurus
Uniprot IdQ08E66
Milk FractionWhey
Ref Sequence Id NP_001070353.1
Aminoacid Length 574
Molecular Weight 62994
Fasta Sequence https://www.uniprot.org/uniprot/Q08E66.fasta
Gene Name WFIKKN2
Gene Id 531979
Protein Existence Status reviewed

Secondary Information

Protein Function an antimyostatic agent
Biochemical Properties WFIKKN2 has practically no affinity for the prodomain, its ability to inhibit the activity of latent myostatin preparations may be mediated only by its interaction with the growth factor domain.
PTMs Glycosylation at Aspn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08E66|WFKN2_BOVIN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Bos taurus OX=9913 GN=WFIKKN2 PE=2 SV=1 MWALRGCRSGSRWGQGAALLLLLLGVPPRGLALPPLRYSHAGICPNDMNPNLWVDAQSTC KRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSE CDIWDGQPVCKCRDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWP NTSPSPPETTVHPTTAPPETPGLDATAPALLNHPAHQSVTVGETVSFLCDVVGRPRPEIT WEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPL SVVSGGQASATAESSPNGTALPAAECLKPPDSDDCGEEQTRWYFDAQANNCLTFTFGHCH RNRNHFETYEACMLACMSGSLAMCSLPALQGPCKAYVPRWAYNSQTGQCQSFVYGGCEGN GNNFESREDCEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRISELTEEPDSGRAL VTVDEVLKDEKMGLKFLGQEPLEVTLLHMDWTCPCPN*517VTVGEAPLIIMGEVDGGMAVLRP DSFVGASSTRRARKLREVMHKKTCDVLKDFPGLQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments WFIKKN1 may have greater potential as an antimyostatic agent than WFIKKN2.
Bibliography Szláma G, Trexler M, Patthy L. Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2. FEBS J. 2013 Aug;280(16):3822-39. doi: 10.1111/febs.12377. Epub 2013 Jul 5. PMID: 23829672; PMCID: PMC3906830.