Search by BoMiProt ID - Bomi10521


Primary Information

BoMiProt ID Bomi10521
Protein Name von Willebrand factor A domain-containing protein 1
Organism Bos taurus
Uniprot IdA6QLN9
Milk FractionWhey
Ref Sequence Id NP_001096700.1
Aminoacid Length 413
Molecular Weight 43738
Fasta Sequence https://www.uniprot.org/uniprot/A6QLN9.fasta
Gene Name VWA1
Gene Id 505917
Protein Existence Status reviewed

Secondary Information

Biochemical Properties Homodimer or homomultimer; disulfide-linked.Interacts with HSPG2
PTMs Phosphorylation and N linked Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLN9|VWA1_BOVIN von Willebrand factor A domain-containing protein 1 OS=Bos taurus OX=9913 GN=VWA1 PE=2 SV=1 MLPWTVIGLALSLRLARSGAERGLPASALQGDLLFLLDSSASVSHYEFNRVREFLGRLAA LLPVGPGALRAS*72LVHVGS*78RPHTEFPFGQHSS*91GSAVQDAIRAAAQRMGDTNTGLALAYAKK QLFAKAAGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNLLELSAAA SAPAEKHLHFVDVDDLHIITQALRGSILDAMWPQQLHASEVTSSGFRLAWPSLLTADSGY YVLELAPSTDPGAARRQQLPGN*262ATGWAWTGLDSDTDYDVALVPESNVRLLRSQHLRVRTL PEETGPELIVVSHTRPRSLRVSWAPALGPDAALGYHVQVGPLRGGAAQSVEVPAGENSTT LQGLAPGTAYLVTVTAAFRSGRERALSAKACTPEGERSRAPRPQPQRTGGREP
Predicted Disorder Regions 3 predicted disorder segments; (253-260),(345-355),(382-413)
DisProt Annotation
TM Helix Prediction No TM helices