Search by BoMiProt ID - Bomi10505


Primary Information

BoMiProt ID Bomi10505
Protein Name Voltage-dependent L-type calcium channel subunit beta-3/CAB3/Calcium channel voltage-dependent subunit beta 3
Organism Bos taurus
Uniprot IdQ9MZL3
Milk Fractionwhey
Ref Sequence Id NP_776934.1
Aminoacid Length 484
Molecular Weight 54569
Fasta Sequence https://www.uniprot.org/uniprot/Q9MZL3.fasta
Gene Name CACNB3
Gene Id 282160
Protein Existence Status Reviewed

Secondary Information

Protein Function It increases peak calcium current of CACNA1B and CACNA1B and shifts the voltage dependencies of channel activation and inactivation
Biochemical Properties Interacts with CBARP; prevents the interaction of CACNB3 with the alpha subunit CACNA1C thereby negatively regulating the activity of the corresponding calcium channel
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9MZL3|CACB3_BOVIN Voltage-dependent L-type calcium channel subunit beta-3 OS=Bos taurus OX=9913 GN=CACNB3 PE=2 SV=2 MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS PQRLESIRLKQEQKARRSGNPSSLSDIGSRRS*152PPPSLAKQKQKQAEHIPPYDVVPSMRPV VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHS*393PLERDSLMPSDEASESSRQAWTGSSQR SSRHLEEDYADAYHDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHNERNWQRNRPWP KDSY
Predicted Disorder Regions 1-56, 132-172, 307-317, 363-377, 387-484
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Cahill, A. L., Hurley, J. H., & Fox, A. P. (2000). Coexpression of cloned alpha(1B), beta(2a), and alpha(2)/delta subunits produces non-inactivating calcium currents similar to those found in bovine chromaffin cells. The Journal of neuroscience : the official journal of the Society for Neuroscience, 20(5), 1685–1693. https://doi.org/10.1523/JNEUROSCI.20-05-01685.2000