Search by BoMiProt ID - Bomi10501


Primary Information

BoMiProt ID Bomi10501
Protein Name Voltage-dependent L-type calcium channel subunit beta-1/CAB1/Calcium channel voltage-dependent subunit beta 1
Organism Bos taurus
Uniprot IdQ9MZL7
Milk FractionWhey
Aminoacid Length 562
Molecular Weight 61087
Fasta Sequence https://www.uniprot.org/uniprot/F1MHM1.fasta
Gene Name CACNB1
Gene Id 327703
Protein Existence Status reviewed

Secondary Information

Protein Function Regulatory subunit of L type calcium channels.The β subunit contributes to voltage gated calcium channel function by increasing peak Ca2+ current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling α1 subunit membrane targeting
PTMs Phosphorylation on Ser and Thr
Additional Comments expressed at high levels in brain and skeletal muscle, and at much lower levels in spleen and heart.Absence of the β1 subunit results in failure of transport and insertion of the α1 subunit into the plasmalemmal membrane.Absence of the β1 subunit modifies the Ca2+ current, and eliminates excitation-contraction coupling in skeletal muscle.
Linking IDs Bomi10501
Bibliography 1.Hogan K, Greg RG, Powers PA. Structure and alternative splicing of the gene encoding the human beta1 subunit of voltage dependent calcium channels. Neurosci Lett. 1999 Dec 24;277(2):111-4. doi: 10.1016/s0304-3940(99)00851-4. PMID: 10624822. 2.Freise, D., Held, B., Wissenbach, U., Pfeifer, A., Trost, C., Himmerkus, N., ... & Flockerzi, V. (2000). Absence of the γ subunit of the skeletal muscle dihydropyridine receptor increases L-type Ca2+ currents and alters channel inactivation properties. Journal of Biological Chemistry, 275(19), 14476-14481.
Protein Function Regulatory subunit of L type calcium channels.The β subunit contributes to voltage gated calcium channel function by increasing peak Ca2+ current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling α1 subunit membrane targeting
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9MZL7|CACB1_BOVIN Voltage-dependent L-type calcium channel subunit beta-1 OS=Bos taurus OX=9913 GN=CACNB1 PE=1 SV=1 MVQKTSMSRGPYPSSQEIPMEVFDPSPQGKYSKRKGRFKRSDGS*44TSS*47DTTSNSFVRQGSA ESYTSRPSDSDVS*73LEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR LSSSKS*186GDNSSSS*193LGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP NPLLNRTMATAALAASPAPVSNLQGPYLASGDQSLERATGEHASVHEYPGELGQPPGLYP SSHPPGRAGTLRALSRQDT*493FDADTPGNRNSAYTELGDSCVDMETDPSEGPGLGDPAGGST PPARQGS*547WEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Predicted Disorder Regions 30-78, 95-98, 183-214, 359-367, 431-458, 511-514, 531-563
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments expressed at high levels in brain and skeletal muscle, and at much lower levels in spleen and heart.Absence of the β1 subunit results in failure of transport and insertion of the α1 subunit into the plasmalemmal membrane.Absence of the β1 subunit modifies the Ca2+ current, and eliminates excitation-contraction coupling in skeletal muscle.
Linking IDs
Bibliography 1.Hogan K, Greg RG, Powers PA. Structure and alternative splicing of the gene encoding the human beta1 subunit of voltage dependent calcium channels. Neurosci Lett. 1999 Dec 24;277(2):111-4. doi: 10.1016/s0304-3940(99)00851-4. PMID: 10624822. 2.Freise, D., Held, B., Wissenbach, U., Pfeifer, A., Trost, C., Himmerkus, N., ... & Flockerzi, V. (2000). Absence of the γ subunit of the skeletal muscle dihydropyridine receptor increases L-type Ca2+ currents and alters channel inactivation properties. Journal of Biological Chemistry, 275(19), 14476-14481.