Primary Information | |
---|---|
BoMiProt ID | Bomi105 |
Protein Name | Beta-casein |
Organism | Bos taurus |
Uniprot Id | P02666 |
Milk Fraction | Whey |
Amino Acid Lenth | 224 |
Molecular Weight | 25107 |
Fasta Sequence | https://www.uniprot.org/uniprot/P02666.fasta |
Gene Name | CSN2 |
Protein Existence Status | Reviewed: Experimental evidence at protein level |
Secondry Information | |
Endogenous/Bioactive peptides - Fragment - Sequence - Effect | ß casomorphin-11 - 60–70 - YPFPGPIPNSL - Opioid Ref ß casomorphin-7 - 60–66 - YPFPGPI - Opioid ACE Inhibitory, Immunomodulatory Ref ß casomorphin-5 - 60–64 - YPFPG - Opioid ACE Inhibitory Ref ß casokinin-7 - 177–183 - AVPYPQR - ACE Inhibitory Ref ß casokinin-10 - 193–202 YQQPVLGPVR - ACE Inhibitory, Immunomodulatory Ref 169–175 - KVLPVPQ - ACE inhibition Ref Immunopeptide - 63–68 - PGPIPN - Immunomodulatory Ref Immunopeptide - 191–193 - LLY - Immunomodulatory Ref ß casochemotide -1114–118 - YPVEP - Immunomodulatory Ref 210–221 - EPVLGPVRGPFP - ACE-inhibition Ref Caseinophosphopeptide - (1–25)4P -RELEELNVPGEIVESLSSSEESITR - Ca++ binding Ref |
Protein Function | ß-caseinomorph stimulate human lymphocyte T proliferation in vitro; ha cytomodulatory properties; enhances nutritional quality in food becausenof high lysine content; film-forming properties of casein may also be used, either as coatings or to reduce oil absorption during the cooking/frying stage in preparing the food |
Biochemical Properties | ß-caseinomorph, a peptide originating from ß-casein is very stable with regard to enzymatic degradation; a substrate for dipeptidyl peptidase IV; exhibits a strong opioid activity; insoluble at pH 4.6; coagulable following specifi c, limited proteolysis; pH 6.7 may be heated at 100ºC for 24 h without coagulation and withstands heating at 140ºC for up to 20–25 min; casein can be precipitated by any of several salts, usually by (NH 4 ) 2 SO 4 at 260 g/L or saturated NaCl; high levels of proline; lack of α - and β -structures; low in sulfur |
Significance in milk | prime source of calcium and phosphorus for the neonate; antigen capable of inducing a prolonged immune response. Increased levels of casein antibodies have been found in individuals with schizophrenia before and after diagnosis |
PTMs | Phosphorylated; presence of 5 phosphates in bovine; site of phosphorylation: Ser-Xxx-Glu/pSer; of 12 genetic variants of β -casein in bovine only two variants appear to have altered phosphorylation; Equine β -casein shows variation in phosphorylation, with typically 3 to 7 phosphates on full-length β -casein; the β -casein of human milk exists as six different forms with 0 to 5 phosphates; Ovine β -casein has variable phosphorylation, with 0 to 7 phosphates |
Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P02666|CASB_BOVIN Beta-casein OS=Bos taurus OX=9913 GN=CSN2 PE=1 SV=2 MKVLILACLVALALARELEELNVPGEIVES*30LS*32S*32S*34EESITRINKKIEKFQS*50EEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV |
Bibliography | 1. Niebuhr, D. W., Li, Y., Cowan, D. N., Weber, N. S., Fisher, J. A., Ford, G. M., & Yolken, R. (2011). Association between bovine casein antibody and new onset schizophrenia among US military personnel. Schizophrenia Research, 128(1–3), 51–55. https://doi.org/10.1016/j.schres.2011.02.005. 2. Ferranti, P., Pizzano, R., Garro, G., Caira, S., Chianese, L., & Addeo, F. (2001). Mass spectrometry-based procedure for the identification of ovine casein heterogeneity. Journal of Dairy Research, 68(1), 35–51. https://doi.org/10.1017/S0022029900004611. 3. Greenberg, R., Groves, M. L., & Dower, H. J. (1984). Human beta-casein. Amino acid sequence and identification of phosphorylation sites. The Journal of Biological Chemistry, 259(8), 5132–5138. Retrieved from http://www.ncbi.nlm.nih.gov/pubmed/6715339. 4. Sato R, Shindo M, Gunshin H, Noguchi T, Naito H. Characterization of phosphopeptide derived from bovine β-casein: an inhibitor to intra-intestinal precipitation of calcium phosphate. Biochim Biophys Acta (BBA)/Protein Struct Mol. 1991 Apr 29;1077(3):413–5. 5. Hayes M, Stanton C, Slattery H, O’Sullivan O, Hill C, Fitzgerald GF, et al. Casein fermentate of Lactobacillus animalis DPC6134 contains a range of novel propeptide angiotensin-converting enzyme inhibitors. Appl Environ Microbiol. 2007 Jul;73(14):4658–67. 6. Kitazawa H, Yonezawa K, Tohno M, Shimosato T, Kawai Y, Saito T, et al. Enzymatic digestion of the milk protein β-casein releases potent chemotactic peptide(s) for monocytes and macrophages. Int Immunopharmacol. 2007 Sep;7(9):1150–9. 7. Migliore-Samour D, Floc’h F, Jollès P. Biologically active casein peptides implicated in immunomodulation. J Dairy Res [Internet]. 1989 [cited 2019 Nov 26];56(3):357–62. Available from: http://www.ncbi.nlm.nih.gov/pubmed/2668358. 8. Cieślińska A, Kostyra E, Kostyra H, Oleński K, Fiedorowicz E, Kamiński S. Milk from cows of different β-casein genotypes as a source of β-casomorphin-7. Int J Food Sci Nutr. 2012 Jun;63(4):426–30. 9. Maeno M, Yamamoto N, Takano T. Identification of an Antihypertensive Peptide from Casein Hydrolysate Produced by a Proteinase from Lactobacillus helveticus CP790. J Dairy Sci. 1996;79(8):1316–21. 10. Maruyama S, Suzuki H. A Peptide Inhibitor of Angiotensin I Converting Enzyme in the Tryptic Hydrolysate of Casein. Agric Biol Chem [Internet]. 1982 May 9 [cited 2019 Nov 26];46(5):1393–4. Available from: http://www.tandfonline.com/doi/full/10.1080/00021369.1982.10865255. 11. Maruyama S, Nakagomi K, Tomizuka N, Suzuki H. Angiotensin i-converting enzyme inhibitor derived from an enzymatic hydrolysate of casein. Ii. isolation and bradykinin-potentiating activity on the uterus and the ileum of rats. Agric Biol Chem. 1985;49(5):1405–9. 12. Meisel H. Chemical characterization and opioid activity of an exorphin isolated from in vivo digests of casein. FEBS Lett. 1986 Feb 17;196(2):223–7. |