Search by BoMiProt ID - Bomi10489


Primary Information

BoMiProt ID Bomi10489
Protein Name Vitrin
Organism Bos taurus
Uniprot IdQ95LI2
Milk FractionWhey
Ref Sequence Id NP_776396.1
Aminoacid Length 652
Molecular Weight 70873
Fasta Sequence https://www.uniprot.org/uniprot/Q95LI2.fasta
Gene Name VIT
Gene Id 280957
Protein Existence Status reviewed

Secondary Information

Protein Function  An extracellular matrix (ECM) protein. The protein may be associated with cell adhesion and migration.Vitrin along with the microtubule associated protein 1 light chain 3 γ (MAP1LC3C), aggrecan (ACAN), alkaline ceramidase 2 (ACER2), potassium calcium-activated channel subfamily M α 1 (KCNMA1) and synaptopodin 2 (SYNPO2) genes are highlighted as candidates to trigger both types of hernia(Scrotal and Umbilical Hernia in Pigs)
Biochemical Properties Vitrin displays high structural homology with colchin and Akhirin which consists of one LCCL (Limulus factor C, Coch-5b2, and Lgl1) domain and two von Willebrand factor domains.
PTMs N-linked glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95LI2|VITRN_BOVIN Vitrin OS=Bos taurus OX=9913 GN=VIT PE=2 SV=2 MGIVVLTMKASVIEMFLVLLVTGIQSNQEMTKKMKRPKFTVPQISCDVRAGKITNVEFIV KCPPGCQDPRYHVYGADVYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNG VQSLSLPRWRESFVVSEGKPQKGVTYPSSLTYSSSKSPAAKAGETARADQSPPVPGTAAQ PVTVTQAPGTTAIEATHTTLPKPSPSAGSTASGLRPQPAGQRSKDLGEPALWKPESVLLD AGFVPKEELSTQSLEPASQGDPSCKVDLSFLIDGSSSIGKRRFRIQKQFLTDVAQTLDIG PAGPLMGVVQYGDNPATQFNLKTHMNSQDVKAAIEKISQRGGLSNAGRAISFVTKNFFSK FNGNRGGAPNVAVVMVDGWPTDKVEEASRLARESGVNIFFITIEGASENEKQYMLEPNFA NKAVCRTNGFYSLTVQNWFSLHKTVQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSV GTSNFRTVLQFVAN*494LSREFEISDMDTRIGAMQYTYEQRLEFGFDEYSTKSDVLNAIKRVG YWSGGTSTGAAIHYALEQLFKKSKPNKRKLMILITDGRSYDDIRIPAMLAHHKGVITYAI GVAWAAQDELDIIATHPARDHAFFVDEFDNLYKVVPKVIQNICTEFNSQPRN
Predicted Disorder Regions 146-180, 197-256
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments High levels of expression of the protein in specific parts of the brain suggest its likely role in neural development.
Bibliography 1.Ahsan M, Ohta K, Kuriyama S, Tanaka H. Novel soluble molecule, Akhirin, is expressed in the embryonic chick eyes and exhibits heterophilic cell-adhesion activity. Dev Dyn. 2005 May;233(1):95-104. doi: 10.1002/dvdy.20303. PMID: 15765510. 2.Rodrigues AFG, Ibelli AMG, Peixoto JO, Cantão ME, Oliveira HC, Savoldi IR, Souza MR, Mores MAZ, Carreño LOD, Ledur MC. Genes and SNPs Involved with Scrotal and Umbilical Hernia in Pigs. Genes (Basel). 2021 Jan 27;12(2):166. doi: 10.3390/genes12020166. PMID: 33513662; PMCID: PMC7912685.